BLASTX nr result
ID: Acanthopanax24_contig00023324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023324 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017971306.1| PREDICTED: protein-S-isoprenylcysteine O-met... 166 4e-49 ref|XP_021619591.1| protein-S-isoprenylcysteine O-methyltransfer... 165 6e-49 ref|XP_023531976.1| protein-S-isoprenylcysteine O-methyltransfer... 165 9e-49 ref|XP_022989169.1| protein-S-isoprenylcysteine O-methyltransfer... 165 9e-49 ref|XP_022928548.1| protein-S-isoprenylcysteine O-methyltransfer... 165 9e-49 ref|XP_022148265.1| protein-S-isoprenylcysteine O-methyltransfer... 165 9e-49 ref|XP_007043238.1| PREDICTED: protein-S-isoprenylcysteine O-met... 166 9e-49 gb|AUZ98397.1| protein-S-isoprenylcysteine O-methyltransferase [... 164 1e-48 ref|XP_015583926.1| PREDICTED: protein-S-isoprenylcysteine O-met... 164 1e-48 ref|XP_021619590.1| protein-S-isoprenylcysteine O-methyltransfer... 165 1e-48 gb|KZM84970.1| hypothetical protein DCAR_027608 [Daucus carota s... 164 2e-48 ref|XP_023531975.1| protein-S-isoprenylcysteine O-methyltransfer... 165 2e-48 ref|XP_022989168.1| protein-S-isoprenylcysteine O-methyltransfer... 165 2e-48 ref|XP_022928546.1| protein-S-isoprenylcysteine O-methyltransfer... 165 2e-48 gb|KYP51104.1| Protein-S-isoprenylcysteine O-methyltransferase B... 163 2e-48 ref|XP_021300311.1| protein-S-isoprenylcysteine O-methyltransfer... 165 2e-48 ref|XP_017220980.1| PREDICTED: protein-S-isoprenylcysteine O-met... 164 2e-48 gb|EEF30796.1| protein-s isoprenylcysteine O-methyltransferase, ... 163 3e-48 ref|XP_022958895.1| protein-S-isoprenylcysteine O-methyltransfer... 163 5e-48 ref|XP_020231557.1| protein-S-isoprenylcysteine O-methyltransfer... 163 5e-48 >ref|XP_017971306.1| PREDICTED: protein-S-isoprenylcysteine O-methyltransferase B isoform X2 [Theobroma cacao] Length = 197 Score = 166 bits (419), Expect = 4e-49 Identities = 70/86 (81%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+L+THG+YRFVRHPGYSGFLIWS+GTQIMLCNPIST+AFA+VVW+FF++RIPYEE Sbjct: 112 HEEHHQLITHGVYRFVRHPGYSGFLIWSVGTQIMLCNPISTIAFAIVVWQFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 +FL+QFFGS Y+DYA +VPSGVP VK Sbjct: 172 FFLKQFFGSDYEDYALRVPSGVPFVK 197 >ref|XP_021619591.1| protein-S-isoprenylcysteine O-methyltransferase B-like isoform X2 [Manihot esculenta] gb|OAY43064.1| hypothetical protein MANES_08G039100 [Manihot esculenta] Length = 197 Score = 165 bits (418), Expect = 6e-49 Identities = 71/86 (82%), Positives = 80/86 (93%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHHKL+THGIYRFVRHPGY+GF IWS+ TQIMLCNPIST+ FAVVVWRFF++RIPYEE Sbjct: 112 HEEHHKLITHGIYRFVRHPGYAGFFIWSVSTQIMLCNPISTIGFAVVVWRFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLR FFGSQY++YAQ+ PSGVP VK Sbjct: 172 YFLRHFFGSQYEEYAQRTPSGVPFVK 197 >ref|XP_023531976.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 197 Score = 165 bits (417), Expect = 9e-49 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 112 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 172 YFLRQFFGHEYEEYARRVPSGVPFVK 197 >ref|XP_022989169.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X2 [Cucurbita maxima] Length = 197 Score = 165 bits (417), Expect = 9e-49 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 112 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 172 YFLRQFFGHEYEEYARRVPSGVPFVK 197 >ref|XP_022928548.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X2 [Cucurbita moschata] Length = 197 Score = 165 bits (417), Expect = 9e-49 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 112 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 172 YFLRQFFGHEYEEYARRVPSGVPFVK 197 >ref|XP_022148265.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148266.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148267.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148268.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148269.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148270.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148271.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148272.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148273.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] ref|XP_022148274.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Momordica charantia] Length = 197 Score = 165 bits (417), Expect = 9e-49 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGYSGFL+W+IGTQIMLCNPIST+AFAVVVW FF++RIPYEE Sbjct: 112 HEDHHKLVTHGVYRFVRHPGYSGFLVWAIGTQIMLCNPISTIAFAVVVWHFFAKRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y +YA +VPSGVP VK Sbjct: 172 YFLRQFFGDEYKEYANRVPSGVPFVK 197 >ref|XP_007043238.1| PREDICTED: protein-S-isoprenylcysteine O-methyltransferase B isoform X1 [Theobroma cacao] ref|XP_017971305.1| PREDICTED: protein-S-isoprenylcysteine O-methyltransferase B isoform X1 [Theobroma cacao] gb|EOX99069.1| Isoprenylcysteine carboxyl methyltransferase family [Theobroma cacao] Length = 222 Score = 166 bits (419), Expect = 9e-49 Identities = 70/86 (81%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+L+THG+YRFVRHPGYSGFLIWS+GTQIMLCNPIST+AFA+VVW+FF++RIPYEE Sbjct: 137 HEEHHQLITHGVYRFVRHPGYSGFLIWSVGTQIMLCNPISTIAFAIVVWQFFAERIPYEE 196 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 +FL+QFFGS Y+DYA +VPSGVP VK Sbjct: 197 FFLKQFFGSDYEDYALRVPSGVPFVK 222 >gb|AUZ98397.1| protein-S-isoprenylcysteine O-methyltransferase [Trachyspermum ammi] Length = 197 Score = 164 bits (416), Expect = 1e-48 Identities = 75/85 (88%), Positives = 80/85 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+LV +G+Y FVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE Sbjct: 112 HEEHHELVRNGVYGFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCV 257 YFLRQFFGS Y+ YAQQVPSG+P V Sbjct: 172 YFLRQFFGSDYNAYAQQVPSGIPFV 196 >ref|XP_015583926.1| PREDICTED: protein-S-isoprenylcysteine O-methyltransferase A [Ricinus communis] gb|EEF28069.1| protein-s isoprenylcysteine O-methyltransferase, putative [Ricinus communis] Length = 197 Score = 164 bits (416), Expect = 1e-48 Identities = 70/86 (81%), Positives = 80/86 (93%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHHKL+THG+YRFVRHP Y GF IWS+GTQIMLCNPIST+AFAVVVW FF+ RIPYEE Sbjct: 112 HEEHHKLITHGVYRFVRHPSYCGFFIWSVGTQIMLCNPISTIAFAVVVWHFFANRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLR+FFGSQY++YA+Q+PSGVP VK Sbjct: 172 YFLRRFFGSQYEEYARQIPSGVPFVK 197 >ref|XP_021619590.1| protein-S-isoprenylcysteine O-methyltransferase B-like isoform X1 [Manihot esculenta] gb|OAY43065.1| hypothetical protein MANES_08G039100 [Manihot esculenta] Length = 222 Score = 165 bits (418), Expect = 1e-48 Identities = 71/86 (82%), Positives = 80/86 (93%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHHKL+THGIYRFVRHPGY+GF IWS+ TQIMLCNPIST+ FAVVVWRFF++RIPYEE Sbjct: 137 HEEHHKLITHGIYRFVRHPGYAGFFIWSVSTQIMLCNPISTIGFAVVVWRFFAERIPYEE 196 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLR FFGSQY++YAQ+ PSGVP VK Sbjct: 197 YFLRHFFGSQYEEYAQRTPSGVPFVK 222 >gb|KZM84970.1| hypothetical protein DCAR_027608 [Daucus carota subsp. sativus] Length = 182 Score = 164 bits (414), Expect = 2e-48 Identities = 71/85 (83%), Positives = 80/85 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+LV HG+Y +VRHPGYSGFLIWS+GTQIMLCNPISTVAF+++VWRFFSQRIPYEE Sbjct: 97 HEEHHELVRHGVYGYVRHPGYSGFLIWSVGTQIMLCNPISTVAFSLIVWRFFSQRIPYEE 156 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCV 257 YFLR+FFGS YD YAQQVPSG+P V Sbjct: 157 YFLREFFGSHYDAYAQQVPSGIPFV 181 >ref|XP_023531975.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 218 Score = 165 bits (417), Expect = 2e-48 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 133 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 192 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 193 YFLRQFFGHEYEEYARRVPSGVPFVK 218 >ref|XP_022989168.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X1 [Cucurbita maxima] Length = 218 Score = 165 bits (417), Expect = 2e-48 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 133 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 192 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 193 YFLRQFFGHEYEEYARRVPSGVPFVK 218 >ref|XP_022928546.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X1 [Cucurbita moschata] ref|XP_022928547.1| protein-S-isoprenylcysteine O-methyltransferase A-like isoform X1 [Cucurbita moschata] Length = 218 Score = 165 bits (417), Expect = 2e-48 Identities = 69/86 (80%), Positives = 83/86 (96%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKLVTHG+YRFVRHPGY+GFL+W++GTQIMLCNPISTVAFA+VVW FF++RIPYEE Sbjct: 133 HEDHHKLVTHGVYRFVRHPGYNGFLVWAVGTQIMLCNPISTVAFAIVVWHFFAERIPYEE 192 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA++VPSGVP VK Sbjct: 193 YFLRQFFGHEYEEYARRVPSGVPFVK 218 >gb|KYP51104.1| Protein-S-isoprenylcysteine O-methyltransferase B [Cajanus cajan] Length = 163 Score = 163 bits (412), Expect = 2e-48 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HH+L+THGIYR++RHPGY GFLIWSIGTQIMLCNPIST AFA VVWRFF+QRIPYEE Sbjct: 78 HEDHHQLITHGIYRYIRHPGYCGFLIWSIGTQIMLCNPISTFAFAAVVWRFFAQRIPYEE 137 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG+QY++YAQ+V SGVP VK Sbjct: 138 YFLRQFFGAQYEEYAQRVGSGVPFVK 163 >ref|XP_021300311.1| protein-S-isoprenylcysteine O-methyltransferase B-like [Herrania umbratica] ref|XP_021300324.1| protein-S-isoprenylcysteine O-methyltransferase B-like [Herrania umbratica] Length = 222 Score = 165 bits (417), Expect = 2e-48 Identities = 70/86 (81%), Positives = 82/86 (95%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+L+THG+YRFVRHPGYSGFLIWS+G QIMLCNPIST+AFA+VVW+FF++RIPYEE Sbjct: 137 HEEHHQLITHGVYRFVRHPGYSGFLIWSVGIQIMLCNPISTIAFAIVVWQFFAERIPYEE 196 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFL+QFFGS Y+DYA +VPSGVP VK Sbjct: 197 YFLKQFFGSDYEDYALRVPSGVPFVK 222 >ref|XP_017220980.1| PREDICTED: protein-S-isoprenylcysteine O-methyltransferase A-like [Daucus carota subsp. sativus] Length = 197 Score = 164 bits (414), Expect = 2e-48 Identities = 71/85 (83%), Positives = 80/85 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHH+LV HG+Y +VRHPGYSGFLIWS+GTQIMLCNPISTVAF+++VWRFFSQRIPYEE Sbjct: 112 HEEHHELVRHGVYGYVRHPGYSGFLIWSVGTQIMLCNPISTVAFSLIVWRFFSQRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCV 257 YFLR+FFGS YD YAQQVPSG+P V Sbjct: 172 YFLREFFGSHYDAYAQQVPSGIPFV 196 >gb|EEF30796.1| protein-s isoprenylcysteine O-methyltransferase, putative [Ricinus communis] Length = 197 Score = 163 bits (413), Expect = 3e-48 Identities = 71/86 (82%), Positives = 79/86 (91%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HEEHHKL+T G+YRFVRHPGY GF IWS+GTQIMLCNPIST+AFAVVVW FF+ RIPYEE Sbjct: 112 HEEHHKLITSGVYRFVRHPGYCGFFIWSVGTQIMLCNPISTIAFAVVVWLFFADRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFGSQY++YAQQ PSGVP +K Sbjct: 172 YFLRQFFGSQYEEYAQQTPSGVPFLK 197 >ref|XP_022958895.1| protein-S-isoprenylcysteine O-methyltransferase B-like [Cucurbita moschata] Length = 197 Score = 163 bits (412), Expect = 5e-48 Identities = 67/86 (77%), Positives = 82/86 (95%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HHKL+T+G+YRF+RHPGYSGFL+W++GTQIMLCNPIST+ FAVVVW+FF++RIPYEE Sbjct: 112 HEDHHKLITYGVYRFIRHPGYSGFLVWAVGTQIMLCNPISTIGFAVVVWQFFAERIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG +Y++YA QVPSGVP VK Sbjct: 172 YFLRQFFGREYEEYANQVPSGVPFVK 197 >ref|XP_020231557.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Cajanus cajan] ref|XP_020231558.1| protein-S-isoprenylcysteine O-methyltransferase A-like [Cajanus cajan] Length = 197 Score = 163 bits (412), Expect = 5e-48 Identities = 71/86 (82%), Positives = 81/86 (94%) Frame = +3 Query: 3 HEEHHKLVTHGIYRFVRHPGYSGFLIWSIGTQIMLCNPISTVAFAVVVWRFFSQRIPYEE 182 HE+HH+L+THGIYR++RHPGY GFLIWSIGTQIMLCNPIST AFA VVWRFF+QRIPYEE Sbjct: 112 HEDHHQLITHGIYRYIRHPGYCGFLIWSIGTQIMLCNPISTFAFAAVVWRFFAQRIPYEE 171 Query: 183 YFLRQFFGSQYDDYAQQVPSGVPCVK 260 YFLRQFFG+QY++YAQ+V SGVP VK Sbjct: 172 YFLRQFFGAQYEEYAQRVGSGVPFVK 197