BLASTX nr result
ID: Acanthopanax24_contig00023220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023220 (955 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049755.1| hypothetical protein (mitochondrion) [Capsic... 97 2e-21 >ref|YP_009049755.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG89975.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG90113.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|PHT29432.1| hypothetical protein CQW23_30978 [Capsicum baccatum] gb|PHT76049.1| hypothetical protein T459_19571 [Capsicum annuum] gb|PHT95624.1| hypothetical protein T459_03506 [Capsicum annuum] Length = 102 Score = 97.1 bits (240), Expect = 2e-21 Identities = 57/102 (55%), Positives = 59/102 (57%), Gaps = 1/102 (0%) Frame = -2 Query: 954 M*TLSQFSFLPLHGSKTSNYYMAXXXXXXXXXXXXXXXXXXXLKLKLQEREKQGN*MSXX 775 M SQF FLPLHGSKTSNYYMA LKLKLQEREK+G Sbjct: 1 MSNFSQFRFLPLHGSKTSNYYMALLLLGQLLRLARRDRQERQLKLKLQEREKEGELDELT 60 Query: 774 XXXXLDRKESGLS-IFQISKIYQSPFEMKTPALLSNFPTACE 652 K +F ISKIYQSPFEMKTPALLSNFPTACE Sbjct: 61 TPTVTGSKREWTEHLFPISKIYQSPFEMKTPALLSNFPTACE 102