BLASTX nr result
ID: Acanthopanax24_contig00023168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023168 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY49847.1| hypothetical protein CUMW_122220 [Citrus unshiu] 59 9e-08 ref|XP_006480947.1| PREDICTED: reticulon-like protein B12 isofor... 59 9e-08 ref|XP_006429275.1| reticulon-like protein B12 [Citrus clementin... 59 9e-08 ref|XP_015386667.1| PREDICTED: reticulon-like protein B12 isofor... 59 1e-07 gb|ONI03620.1| hypothetical protein PRUPE_6G269700 [Prunus persica] 58 2e-07 ref|XP_020420665.1| reticulon-like protein B12 isoform X2 [Prunu... 58 2e-07 ref|XP_020420664.1| reticulon-like protein B12 isoform X1 [Prunu... 58 3e-07 ref|XP_019077209.1| PREDICTED: reticulon-like protein B12 isofor... 57 5e-07 ref|XP_010654209.1| PREDICTED: reticulon-like protein B12 isofor... 57 5e-07 ref|XP_002273700.1| PREDICTED: reticulon-like protein B12 isofor... 57 6e-07 emb|CAN64200.1| hypothetical protein VITISV_014341 [Vitis vinifera] 57 2e-06 ref|XP_021814593.1| reticulon-like protein B12 isoform X2 [Prunu... 55 2e-06 ref|XP_021814592.1| reticulon-like protein B12 isoform X1 [Prunu... 55 3e-06 ref|XP_008239726.1| PREDICTED: reticulon-like protein B12 [Prunu... 55 5e-06 gb|KRH66005.1| hypothetical protein GLYMA_03G076200 [Glycine max] 54 5e-06 ref|XP_014629108.1| PREDICTED: reticulon-like protein B12 isofor... 54 6e-06 gb|KHN22541.1| Reticulon-like protein B12 [Glycine soja] 54 6e-06 ref|XP_003520935.1| PREDICTED: reticulon-like protein B12 isofor... 54 6e-06 >dbj|GAY49847.1| hypothetical protein CUMW_122220 [Citrus unshiu] Length = 210 Score = 59.3 bits (142), Expect = 9e-08 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y ++GYRKL+QLY+ +DEE++SKV WILEKQK Sbjct: 174 DKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQK 208 >ref|XP_006480947.1| PREDICTED: reticulon-like protein B12 isoform X2 [Citrus sinensis] gb|KDO58046.1| hypothetical protein CISIN_1g028337mg [Citrus sinensis] Length = 210 Score = 59.3 bits (142), Expect = 9e-08 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y ++GYRKL+QLY+ +DEE++SKV WILEKQK Sbjct: 174 DKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQK 208 >ref|XP_006429275.1| reticulon-like protein B12 [Citrus clementina] gb|ESR42515.1| hypothetical protein CICLE_v10012753mg [Citrus clementina] Length = 210 Score = 59.3 bits (142), Expect = 9e-08 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y ++GYRKL+QLY+ +DEE++SKV WILEKQK Sbjct: 174 DKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQK 208 >ref|XP_015386667.1| PREDICTED: reticulon-like protein B12 isoform X1 [Citrus sinensis] Length = 217 Score = 59.3 bits (142), Expect = 1e-07 Identities = 23/35 (65%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y ++GYRKL+QLY+ +DEE++SKV WILEKQK Sbjct: 181 DKYAILGYRKLRQLYVKIDEEFVSKVRKWILEKQK 215 >gb|ONI03620.1| hypothetical protein PRUPE_6G269700 [Prunus persica] Length = 210 Score = 58.2 bits (139), Expect = 2e-07 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y++MGYRKL QLY+ LDEEY+++ NW+LEK+K Sbjct: 174 DKYIMMGYRKLLQLYVKLDEEYLNRFQNWVLEKKK 208 >ref|XP_020420665.1| reticulon-like protein B12 isoform X2 [Prunus persica] gb|ONI03621.1| hypothetical protein PRUPE_6G269700 [Prunus persica] Length = 212 Score = 58.2 bits (139), Expect = 2e-07 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y++MGYRKL QLY+ LDEEY+++ NW+LEK+K Sbjct: 176 DKYIMMGYRKLLQLYVKLDEEYLNRFQNWVLEKKK 210 >ref|XP_020420664.1| reticulon-like protein B12 isoform X1 [Prunus persica] gb|ONI03622.1| hypothetical protein PRUPE_6G269700 [Prunus persica] Length = 226 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y++MGYRKL QLY+ LDEEY+++ NW+LEK+K Sbjct: 190 DKYIMMGYRKLLQLYVKLDEEYLNRFQNWVLEKKK 224 >ref|XP_019077209.1| PREDICTED: reticulon-like protein B12 isoform X3 [Vitis vinifera] Length = 183 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 DRYV+MGYRKL+ LY+ LDEE ISKV WILEK+K Sbjct: 147 DRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRK 181 >ref|XP_010654209.1| PREDICTED: reticulon-like protein B12 isoform X2 [Vitis vinifera] Length = 190 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 DRYV+MGYRKL+ LY+ LDEE ISKV WILEK+K Sbjct: 154 DRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRK 188 >ref|XP_002273700.1| PREDICTED: reticulon-like protein B12 isoform X1 [Vitis vinifera] emb|CBI30438.3| unnamed protein product, partial [Vitis vinifera] Length = 209 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 DRYV+MGYRKL+ LY+ LDEE ISKV WILEK+K Sbjct: 173 DRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRK 207 >emb|CAN64200.1| hypothetical protein VITISV_014341 [Vitis vinifera] Length = 445 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 DRYV+MGYRKL+ LY+ LDEE ISKV WILEK+K Sbjct: 409 DRYVMMGYRKLQLLYMKLDEECISKVQKWILEKRK 443 >ref|XP_021814593.1| reticulon-like protein B12 isoform X2 [Prunus avium] Length = 212 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y++MGYRKL QLY+ LD EY+++ NW+LEK+K Sbjct: 176 DKYIMMGYRKLLQLYVKLDVEYLNRFQNWVLEKKK 210 >ref|XP_021814592.1| reticulon-like protein B12 isoform X1 [Prunus avium] Length = 226 Score = 55.5 bits (132), Expect = 3e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y++MGYRKL QLY+ LD EY+++ NW+LEK+K Sbjct: 190 DKYIMMGYRKLLQLYVKLDVEYLNRFQNWVLEKKK 224 >ref|XP_008239726.1| PREDICTED: reticulon-like protein B12 [Prunus mume] Length = 212 Score = 54.7 bits (130), Expect = 5e-06 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D++++MGYRKL QLY+ DEEY+++ NW+LEK+K Sbjct: 176 DKHIMMGYRKLLQLYVKFDEEYLNRFQNWVLEKKK 210 >gb|KRH66005.1| hypothetical protein GLYMA_03G076200 [Glycine max] Length = 193 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y+L GYRKL L++ ++E+Y++KVHNWILEK+K Sbjct: 157 DKYILKGYRKLCLLHLKINEQYVNKVHNWILEKKK 191 >ref|XP_014629108.1| PREDICTED: reticulon-like protein B12 isoform X2 [Glycine max] ref|XP_014629109.1| PREDICTED: reticulon-like protein B12 isoform X2 [Glycine max] gb|KRH66002.1| hypothetical protein GLYMA_03G076200 [Glycine max] Length = 207 Score = 54.3 bits (129), Expect = 6e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y+L GYRKL L++ ++E+Y++KVHNWILEK+K Sbjct: 171 DKYILKGYRKLCLLHLKINEQYVNKVHNWILEKKK 205 >gb|KHN22541.1| Reticulon-like protein B12 [Glycine soja] Length = 207 Score = 54.3 bits (129), Expect = 6e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y+L GYRKL L++ ++E+Y++KVHNWILEK+K Sbjct: 171 DKYILKGYRKLCLLHLKINEQYVNKVHNWILEKKK 205 >ref|XP_003520935.1| PREDICTED: reticulon-like protein B12 isoform X1 [Glycine max] ref|XP_014629107.1| PREDICTED: reticulon-like protein B12 isoform X1 [Glycine max] gb|KRH66003.1| hypothetical protein GLYMA_03G076200 [Glycine max] gb|KRH66004.1| hypothetical protein GLYMA_03G076200 [Glycine max] Length = 209 Score = 54.3 bits (129), Expect = 6e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = +3 Query: 3 DRYVLMGYRKLKQLYITLDEEYISKVHNWILEKQK 107 D+Y+L GYRKL L++ ++E+Y++KVHNWILEK+K Sbjct: 173 DKYILKGYRKLCLLHLKINEQYVNKVHNWILEKKK 207