BLASTX nr result
ID: Acanthopanax24_contig00023083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023083 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP48541.1| Thylakoid membrane protein slr0575 family [Cajanu... 55 5e-06 ref|XP_020233920.1| uncharacterized protein LOC109814013 [Cajanu... 55 5e-06 gb|ABK95719.1| unknown [Populus trichocarpa] 51 7e-06 emb|CBI39337.3| unnamed protein product, partial [Vitis vinifera] 53 8e-06 >gb|KYP48541.1| Thylakoid membrane protein slr0575 family [Cajanus cajan] Length = 283 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 189 KVTEDGKYCLALVFEVKDLQLSDFEKRQ 272 +VTEDGKYCL LVFE KDLQLSDFEKRQ Sbjct: 210 EVTEDGKYCLVLVFEAKDLQLSDFEKRQ 237 >ref|XP_020233920.1| uncharacterized protein LOC109814013 [Cajanus cajan] Length = 286 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 189 KVTEDGKYCLALVFEVKDLQLSDFEKRQ 272 +VTEDGKYCL LVFE KDLQLSDFEKRQ Sbjct: 210 EVTEDGKYCLVLVFEAKDLQLSDFEKRQ 237 >gb|ABK95719.1| unknown [Populus trichocarpa] Length = 70 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +3 Query: 189 KVTEDGKYCLALVFEVKDLQLSDFEKRQ 272 +VTEDGKYCL LVFE K LQLSDFEKRQ Sbjct: 5 EVTEDGKYCLVLVFESKALQLSDFEKRQ 32 >emb|CBI39337.3| unnamed protein product, partial [Vitis vinifera] Length = 160 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +3 Query: 180 SFHKVTEDGKYCLALVFEVKDLQLSDFEKRQ 272 +F VTEDGKYCL LVFE K LQLSDFEKRQ Sbjct: 112 NFWMVTEDGKYCLVLVFEAKALQLSDFEKRQ 142