BLASTX nr result
ID: Acanthopanax24_contig00022869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00022869 (509 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KUM46800.1| hypothetical protein ABT39_MTgene6255 (mitochondr... 62 2e-09 >gb|KUM46800.1| hypothetical protein ABT39_MTgene6255 (mitochondrion) [Picea glauca] Length = 104 Score = 62.0 bits (149), Expect = 2e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -2 Query: 112 TGNRISMEAIPICSYYQISTSDPISHSPTPGERG 11 TGNRISMEAIP CSYYQISTSDPISHSPT +G Sbjct: 19 TGNRISMEAIPRCSYYQISTSDPISHSPTQRGKG 52