BLASTX nr result
ID: Acanthopanax24_contig00022802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00022802 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236077.1| PREDICTED: uncharacterized protein LOC108209... 74 2e-12 gb|KZM95901.1| hypothetical protein DCAR_019143 [Daucus carota s... 73 4e-12 ref|XP_017249388.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 ref|XP_017249385.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 ref|XP_017249387.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 ref|XP_017249386.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 ref|XP_017249384.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 ref|XP_017249383.1| PREDICTED: uncharacterized protein LOC108220... 73 4e-12 emb|CDP04315.1| unnamed protein product [Coffea canephora] 65 3e-09 ref|XP_015073962.1| PREDICTED: uncharacterized protein LOC107018... 62 4e-08 ref|XP_010319845.1| PREDICTED: uncharacterized protein LOC101251... 62 4e-08 ref|XP_015073961.1| PREDICTED: uncharacterized protein LOC107018... 62 4e-08 ref|XP_010319844.1| PREDICTED: uncharacterized protein LOC101251... 62 4e-08 ref|XP_010319842.1| PREDICTED: uncharacterized protein LOC101251... 62 4e-08 ref|XP_015073960.1| PREDICTED: uncharacterized protein LOC107018... 62 4e-08 ref|XP_015073959.1| PREDICTED: uncharacterized protein LOC107018... 62 4e-08 ref|XP_015073958.1| PREDICTED: uncharacterized protein LOC107018... 62 4e-08 ref|XP_020215229.1| uncharacterized protein LOC109799122 isoform... 62 4e-08 ref|XP_020215230.1| uncharacterized protein LOC109799122 isoform... 62 4e-08 ref|XP_020215228.1| uncharacterized protein LOC109799122 isoform... 62 4e-08 >ref|XP_017236077.1| PREDICTED: uncharacterized protein LOC108209600 [Daucus carota subsp. sativus] gb|KZN05639.1| hypothetical protein DCAR_006476 [Daucus carota subsp. sativus] Length = 899 Score = 73.9 bits (180), Expect = 2e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 11 LRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 +RN+ +AELQ NEKLG N Y+GYGDY+LQPSSGDLYTRVFGM Sbjct: 856 VRNDTSIAELQRNEKLGLNNCYTGYGDYMLQPSSGDLYTRVFGM 899 >gb|KZM95901.1| hypothetical protein DCAR_019143 [Daucus carota subsp. sativus] Length = 873 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 828 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 873 >ref|XP_017249388.1| PREDICTED: uncharacterized protein LOC108220200 isoform X6 [Daucus carota subsp. sativus] Length = 874 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 829 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 874 >ref|XP_017249385.1| PREDICTED: uncharacterized protein LOC108220200 isoform X3 [Daucus carota subsp. sativus] Length = 888 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 843 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 888 >ref|XP_017249387.1| PREDICTED: uncharacterized protein LOC108220200 isoform X5 [Daucus carota subsp. sativus] Length = 902 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 857 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 902 >ref|XP_017249386.1| PREDICTED: uncharacterized protein LOC108220200 isoform X4 [Daucus carota subsp. sativus] Length = 903 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 858 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 903 >ref|XP_017249384.1| PREDICTED: uncharacterized protein LOC108220200 isoform X2 [Daucus carota subsp. sativus] Length = 908 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 863 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 908 >ref|XP_017249383.1| PREDICTED: uncharacterized protein LOC108220200 isoform X1 [Daucus carota subsp. sativus] Length = 909 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +2 Query: 5 MQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQPSSGDLYTRVFGM 142 M+LRNE GMAE+ SNE+ GFN++ SGYGD+I QPSSGD Y RVFGM Sbjct: 864 MRLRNEPGMAEVMSNERSGFNRYCSGYGDHIFQPSSGDRYPRVFGM 909 >emb|CDP04315.1| unnamed protein product [Coffea canephora] Length = 844 Score = 65.1 bits (157), Expect = 3e-09 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +2 Query: 2 EMQLRNEMGMAELQSNEKLGFNKFYSGYGDYILQ-PSSGDLYTRVFGM 142 E+Q RNE +AE Q +EKLG NK+ SGYGD + Q PSSGD+YTRVFGM Sbjct: 797 EVQRRNEAAIAEHQRSEKLGLNKYLSGYGDLMFQMPSSGDVYTRVFGM 844 >ref|XP_015073962.1| PREDICTED: uncharacterized protein LOC107018096 isoform X5 [Solanum pennellii] Length = 861 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 815 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 861 >ref|XP_010319845.1| PREDICTED: uncharacterized protein LOC101251877 isoform X4 [Solanum lycopersicum] Length = 861 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 815 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 861 >ref|XP_015073961.1| PREDICTED: uncharacterized protein LOC107018096 isoform X4 [Solanum pennellii] Length = 863 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 817 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 863 >ref|XP_010319844.1| PREDICTED: uncharacterized protein LOC101251877 isoform X3 [Solanum lycopersicum] Length = 863 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 817 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 863 >ref|XP_010319842.1| PREDICTED: uncharacterized protein LOC101251877 isoform X1 [Solanum lycopersicum] ref|XP_010319843.1| PREDICTED: uncharacterized protein LOC101251877 isoform X2 [Solanum lycopersicum] Length = 865 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 819 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 865 >ref|XP_015073960.1| PREDICTED: uncharacterized protein LOC107018096 isoform X3 [Solanum pennellii] Length = 874 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 828 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 874 >ref|XP_015073959.1| PREDICTED: uncharacterized protein LOC107018096 isoform X2 [Solanum pennellii] Length = 895 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 849 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 895 >ref|XP_015073958.1| PREDICTED: uncharacterized protein LOC107018096 isoform X1 [Solanum pennellii] Length = 899 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/47 (65%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = +2 Query: 8 QLRNEM-GMAELQSNEKLGFNKFYSGYGDYILQPS-SGDLYTRVFGM 142 Q RNE+ GMAELQ NE+LGFNK+Y+GYG+ +Q S SGD++ RVFGM Sbjct: 853 QCRNEVDGMAELQRNERLGFNKYYNGYGNQTVQGSGSGDVFARVFGM 899 >ref|XP_020215229.1| uncharacterized protein LOC109799122 isoform X5 [Cajanus cajan] Length = 1020 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +2 Query: 2 EMQLRNEMGMAELQSNEKLGFNKFYSGYGD-YILQPSSGDLYTRVFGM 142 EMQ N +G+AEL NE+LGFNKFYSGY D P+SGDLY R FGM Sbjct: 973 EMQGGNGLGVAELLRNERLGFNKFYSGYDDSKFRMPNSGDLYNRTFGM 1020 >ref|XP_020215230.1| uncharacterized protein LOC109799122 isoform X6 [Cajanus cajan] Length = 1020 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +2 Query: 2 EMQLRNEMGMAELQSNEKLGFNKFYSGYGD-YILQPSSGDLYTRVFGM 142 EMQ N +G+AEL NE+LGFNKFYSGY D P+SGDLY R FGM Sbjct: 973 EMQGGNGLGVAELLRNERLGFNKFYSGYDDSKFRMPNSGDLYNRTFGM 1020 >ref|XP_020215228.1| uncharacterized protein LOC109799122 isoform X4 [Cajanus cajan] Length = 1021 Score = 61.6 bits (148), Expect = 4e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +2 Query: 2 EMQLRNEMGMAELQSNEKLGFNKFYSGYGD-YILQPSSGDLYTRVFGM 142 EMQ N +G+AEL NE+LGFNKFYSGY D P+SGDLY R FGM Sbjct: 974 EMQGGNGLGVAELLRNERLGFNKFYSGYDDSKFRMPNSGDLYNRTFGM 1021