BLASTX nr result
ID: Acanthopanax24_contig00021974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00021974 (868 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AOF43486.1| C2H2 family protein [Populus trichocarpa] >gi|133... 60 1e-06 ref|XP_011033847.1| PREDICTED: zinc finger protein ZAT9-like iso... 58 9e-06 ref|XP_011033839.1| PREDICTED: zinc finger protein ZAT9-like iso... 58 9e-06 >gb|AOF43486.1| C2H2 family protein [Populus trichocarpa] gb|PNT03347.1| hypothetical protein POPTR_014G066100v3 [Populus trichocarpa] Length = 391 Score = 60.5 bits (145), Expect = 1e-06 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -3 Query: 452 DEEQNQEEEGKGVLIYGLRENPKKGIRLVDREFSFYCSKLNYVVLNQDRESE 297 +EE+ +EEE KGVL YGLRENPK+ IRLVD EF F + VVL QDRESE Sbjct: 67 EEEEEEEEEEKGVL-YGLRENPKRSIRLVDPEFCFAAADAGSVVL-QDRESE 116 >ref|XP_011033847.1| PREDICTED: zinc finger protein ZAT9-like isoform X2 [Populus euphratica] Length = 388 Score = 57.8 bits (138), Expect = 9e-06 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 452 DEEQNQEEEGKGVLIYGLRENPKKGIRLVDREFSFYCSKLNYVVLNQDRESE 297 +EE+ EEE KG+ YGLRENPK+ IRLVD EF F + VVL QDRESE Sbjct: 70 EEEEEDEEEEKGIF-YGLRENPKRSIRLVDPEFCFAAADAGSVVL-QDRESE 119 >ref|XP_011033839.1| PREDICTED: zinc finger protein ZAT9-like isoform X1 [Populus euphratica] Length = 399 Score = 57.8 bits (138), Expect = 9e-06 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 452 DEEQNQEEEGKGVLIYGLRENPKKGIRLVDREFSFYCSKLNYVVLNQDRESE 297 +EE+ EEE KG+ YGLRENPK+ IRLVD EF F + VVL QDRESE Sbjct: 70 EEEEEDEEEEKGIF-YGLRENPKRSIRLVDPEFCFAAADAGSVVL-QDRESE 119