BLASTX nr result
ID: Acanthopanax24_contig00021802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00021802 (594 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44256.1| hypothetical protein MIMGU_mgv1a004254mg [Erythra... 57 5e-06 >gb|EYU44256.1| hypothetical protein MIMGU_mgv1a004254mg [Erythranthe guttata] Length = 537 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = -1 Query: 489 QKNVFGDETKMGLGDTTSKLES-VRNIDARQLNIKYVFMAILVLVISVFAASLIQH 325 ++ F E K L D+TS+L + VRNID RQL KYVF+A+LVL I FAA L QH Sbjct: 482 EQRSFKTEIKTDLTDSTSELNNTVRNIDTRQLKFKYVFIAVLVLAIPAFAAFLFQH 537