BLASTX nr result
ID: Acanthopanax24_contig00021599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00021599 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236705.1| PREDICTED: uncharacterized protein LOC108209... 78 6e-14 gb|KZN08874.1| hypothetical protein DCAR_001530 [Daucus carota s... 77 1e-13 >ref|XP_017236705.1| PREDICTED: uncharacterized protein LOC108209986 [Daucus carota subsp. sativus] Length = 251 Score = 77.8 bits (190), Expect = 6e-14 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = +3 Query: 12 EYKLTTVFRGWFSYRKLSLSSDPNFKQKSYSNSPKLSNGLLGCFRNVVRGYTNKHHPRIE 191 EYKL T+ RGWFSYR++S S +PNF KS S S S+G LG F+NV+ GY NK PRIE Sbjct: 190 EYKLATILRGWFSYRRVSSSPEPNFNSKSISRS---SSGFLGSFKNVIMGYNNKQIPRIE 246 Query: 192 TWKAK 206 K + Sbjct: 247 NLKVQ 251 >gb|KZN08874.1| hypothetical protein DCAR_001530 [Daucus carota subsp. sativus] Length = 261 Score = 77.4 bits (189), Expect = 1e-13 Identities = 37/63 (58%), Positives = 44/63 (69%) Frame = +3 Query: 12 EYKLTTVFRGWFSYRKLSLSSDPNFKQKSYSNSPKLSNGLLGCFRNVVRGYTNKHHPRIE 191 EYKL T+ RGWFSYR++S S +PNF KS S S S+G LG F+NV+ GY NK PRIE Sbjct: 190 EYKLATILRGWFSYRRVSSSPEPNFNSKSISRS---SSGFLGSFKNVIMGYNNKQIPRIE 246 Query: 192 TWK 200 K Sbjct: 247 NLK 249