BLASTX nr result
ID: Acanthopanax24_contig00021598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00021598 (668 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236705.1| PREDICTED: uncharacterized protein LOC108209... 78 1e-13 gb|KZN08874.1| hypothetical protein DCAR_001530 [Daucus carota s... 77 2e-13 gb|EYU20254.1| hypothetical protein MIMGU_mgv1a025721mg, partial... 56 6e-06 ref|XP_012857799.1| PREDICTED: uncharacterized protein LOC105977... 56 7e-06 >ref|XP_017236705.1| PREDICTED: uncharacterized protein LOC108209986 [Daucus carota subsp. sativus] Length = 251 Score = 77.8 bits (190), Expect = 1e-13 Identities = 36/65 (55%), Positives = 46/65 (70%) Frame = +1 Query: 16 EYRLTTVFRGWFSYRKLSLSSDPNFKQKSYSNSPKFSKGLLGCFRNVVRGYSNKNYPRIE 195 EY+L T+ RGWFSYR++S S +PNF KS S S S G LG F+NV+ GY+NK PRIE Sbjct: 190 EYKLATILRGWFSYRRVSSSPEPNFNSKSISRS---SSGFLGSFKNVIMGYNNKQIPRIE 246 Query: 196 SWKAK 210 + K + Sbjct: 247 NLKVQ 251 >gb|KZN08874.1| hypothetical protein DCAR_001530 [Daucus carota subsp. sativus] Length = 261 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = +1 Query: 16 EYRLTTVFRGWFSYRKLSLSSDPNFKQKSYSNSPKFSKGLLGCFRNVVRGYSNKNYPRIE 195 EY+L T+ RGWFSYR++S S +PNF KS S S S G LG F+NV+ GY+NK PRIE Sbjct: 190 EYKLATILRGWFSYRRVSSSPEPNFNSKSISRS---SSGFLGSFKNVIMGYNNKQIPRIE 246 Query: 196 SWK 204 + K Sbjct: 247 NLK 249 >gb|EYU20254.1| hypothetical protein MIMGU_mgv1a025721mg, partial [Erythranthe guttata] Length = 223 Score = 56.2 bits (134), Expect = 6e-06 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +1 Query: 1 VITHCEYRLTTVFRGWFSYRKLSLSSDPNFK-QKSYSNSPKFSKGLLGCFRNVVR-GYSN 174 VI+ EYRLT +FRGWF YRKL+ S N + Q+ +NS +FS +LG F+N +R SN Sbjct: 155 VISRREYRLTHLFRGWFPYRKLTSS---NMRIQERRTNSSRFSYNMLGGFKNCLRPPSSN 211 Query: 175 KNYPRIESWKAK 210 K ++WK + Sbjct: 212 KYVSHRQTWKGR 223 >ref|XP_012857799.1| PREDICTED: uncharacterized protein LOC105977084 [Erythranthe guttata] Length = 254 Score = 56.2 bits (134), Expect = 7e-06 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = +1 Query: 1 VITHCEYRLTTVFRGWFSYRKLSLSSDPNFK-QKSYSNSPKFSKGLLGCFRNVVR-GYSN 174 VI+ EYRLT +FRGWF YRKL+ S N + Q+ +NS +FS +LG F+N +R SN Sbjct: 186 VISRREYRLTHLFRGWFPYRKLTSS---NMRIQERRTNSSRFSYNMLGGFKNCLRPPSSN 242 Query: 175 KNYPRIESWKAK 210 K ++WK + Sbjct: 243 KYVSHRQTWKGR 254