BLASTX nr result
ID: Acanthopanax24_contig00021316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00021316 (780 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024173310.1| geranylgeranyl transferase type-2 subunit al... 68 4e-09 ref|XP_017178827.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 67 7e-09 ref|XP_010252399.1| PREDICTED: geranylgeranyl transferase type-2... 66 2e-08 ref|XP_003602893.1| RAB geranylgeranyl transferase alpha protein... 66 2e-08 ref|XP_007222481.2| geranylgeranyl transferase type-2 subunit al... 65 2e-08 gb|OTG19383.1| putative leucine-rich repeat domain, L domain-lik... 62 2e-08 ref|XP_016175138.1| geranylgeranyl transferase type-2 subunit al... 65 4e-08 ref|XP_015939142.1| geranylgeranyl transferase type-2 subunit al... 65 4e-08 ref|XP_016175136.1| geranylgeranyl transferase type-2 subunit al... 65 4e-08 ref|XP_015939140.1| geranylgeranyl transferase type-2 subunit al... 65 4e-08 gb|POF26452.1| geranylgeranyl transferase type-2 subunit alpha 1... 64 5e-08 gb|POF26451.1| geranylgeranyl transferase type-2 subunit alpha 1... 64 5e-08 ref|XP_023910292.1| geranylgeranyl transferase type-2 subunit al... 64 5e-08 ref|XP_004134583.1| PREDICTED: uncharacterized protein LOC101216... 64 7e-08 gb|KVH99702.1| Leucine-rich repeat-containing protein [Cynara ca... 64 9e-08 ref|XP_020213155.1| geranylgeranyl transferase type-2 subunit al... 63 1e-07 gb|KHN08985.1| Geranylgeranyl transferase type-2 subunit alpha [... 63 1e-07 ref|XP_003526554.1| PREDICTED: uncharacterized protein LOC100783... 63 1e-07 gb|KYP71655.1| Geranylgeranyl transferase type-2 subunit alpha [... 63 1e-07 ref|XP_023750490.1| geranylgeranyl transferase type-2 subunit al... 63 2e-07 >ref|XP_024173310.1| geranylgeranyl transferase type-2 subunit alpha 1-like [Rosa chinensis] gb|PRQ21176.1| putative protein geranylgeranyltransferase type II [Rosa chinensis] Length = 704 Score = 67.8 bits (164), Expect = 4e-09 Identities = 37/71 (52%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -2 Query: 212 CVCFDVINSSTVISVV-YLYDLLEPLDTFIMHLFTGLEAMQLLACLNLSNNKLGSFTALD 36 C+C + ++ + + S+ L+ + L +H GLEAMQLL+CLNLSNNKLGSFTAL Sbjct: 541 CLCLNKLSLTRMGSIEKLLWVQMLDLSHNELHSIEGLEAMQLLSCLNLSNNKLGSFTALA 600 Query: 35 PLKLLKSLKVL 3 PL++LKSL+VL Sbjct: 601 PLRMLKSLQVL 611 >ref|XP_017178827.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103401999 [Malus domestica] Length = 690 Score = 67.0 bits (162), Expect = 7e-09 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 +H GLEAMQLL+CLNLSNNKLGSFTAL PLKLL SL+VL Sbjct: 562 LHSLEGLEAMQLLSCLNLSNNKLGSFTALGPLKLLNSLQVL 602 >ref|XP_010252399.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha 1 [Nelumbo nucifera] Length = 685 Score = 65.9 bits (159), Expect = 2e-08 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLSNNKL SFTAL+PLKLLKSLKVL Sbjct: 558 GLEAMQLLSCLNLSNNKLRSFTALEPLKLLKSLKVL 593 >ref|XP_003602893.1| RAB geranylgeranyl transferase alpha protein [Medicago truncatula] gb|AES73144.1| RAB geranylgeranyl transferase alpha protein [Medicago truncatula] Length = 705 Score = 65.9 bits (159), Expect = 2e-08 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 ++ TGLEAMQLL+CLNLS+NK GSFTAL PL+LLKSLKVL Sbjct: 573 VNFLTGLEAMQLLSCLNLSHNKFGSFTALGPLRLLKSLKVL 613 >ref|XP_007222481.2| geranylgeranyl transferase type-2 subunit alpha 1 [Prunus persica] gb|ONI35398.1| hypothetical protein PRUPE_1G533400 [Prunus persica] Length = 698 Score = 65.5 bits (158), Expect = 2e-08 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 +H GLEAMQLL+CLNLSNNKLGS TAL PL+LLKSL+VL Sbjct: 565 LHSIEGLEAMQLLSCLNLSNNKLGSLTALGPLRLLKSLEVL 605 >gb|OTG19383.1| putative leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 149 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 +H GLEA+QLL+CLNLS+N L SFTALDPL+ LKSL+VL Sbjct: 32 LHSIEGLEALQLLSCLNLSHNNLSSFTALDPLRFLKSLRVL 72 >ref|XP_016175138.1| geranylgeranyl transferase type-2 subunit alpha 1 isoform X2 [Arachis ipaensis] Length = 595 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NKLGSFTAL PL+LLKSLKVL Sbjct: 465 GLEAMQLLSCLNLSHNKLGSFTALGPLRLLKSLKVL 500 >ref|XP_015939142.1| geranylgeranyl transferase type-2 subunit alpha 1 isoform X2 [Arachis duranensis] Length = 595 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NKLGSFTAL PL+LLKSLKVL Sbjct: 465 GLEAMQLLSCLNLSHNKLGSFTALGPLRLLKSLKVL 500 >ref|XP_016175136.1| geranylgeranyl transferase type-2 subunit alpha 1 isoform X1 [Arachis ipaensis] Length = 700 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NKLGSFTAL PL+LLKSLKVL Sbjct: 570 GLEAMQLLSCLNLSHNKLGSFTALGPLRLLKSLKVL 605 >ref|XP_015939140.1| geranylgeranyl transferase type-2 subunit alpha 1 isoform X1 [Arachis duranensis] Length = 700 Score = 64.7 bits (156), Expect = 4e-08 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NKLGSFTAL PL+LLKSLKVL Sbjct: 570 GLEAMQLLSCLNLSHNKLGSFTALGPLRLLKSLKVL 605 >gb|POF26452.1| geranylgeranyl transferase type-2 subunit alpha 1 [Quercus suber] Length = 647 Score = 64.3 bits (155), Expect = 5e-08 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLSNNKL SFTAL PL+LLKSLKVL Sbjct: 517 GLEAMQLLSCLNLSNNKLSSFTALGPLRLLKSLKVL 552 >gb|POF26451.1| geranylgeranyl transferase type-2 subunit alpha 1 [Quercus suber] Length = 651 Score = 64.3 bits (155), Expect = 5e-08 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLSNNKL SFTAL PL+LLKSLKVL Sbjct: 521 GLEAMQLLSCLNLSNNKLSSFTALGPLRLLKSLKVL 556 >ref|XP_023910292.1| geranylgeranyl transferase type-2 subunit alpha 1 [Quercus suber] Length = 706 Score = 64.3 bits (155), Expect = 5e-08 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLSNNKL SFTAL PL+LLKSLKVL Sbjct: 576 GLEAMQLLSCLNLSNNKLSSFTALGPLRLLKSLKVL 611 >ref|XP_004134583.1| PREDICTED: uncharacterized protein LOC101216457 [Cucumis sativus] gb|KGN49446.1| hypothetical protein Csa_6G525330 [Cucumis sativus] Length = 695 Score = 63.9 bits (154), Expect = 7e-08 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLE+MQLL+CL+LSNNK+GSFTAL+PL+LLKSLKVL Sbjct: 567 GLESMQLLSCLSLSNNKIGSFTALEPLRLLKSLKVL 602 >gb|KVH99702.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 699 Score = 63.5 bits (153), Expect = 9e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 +H GLEA+QLL+CLNLS+NKLGSF ALDPL+ LKSL++L Sbjct: 566 LHSIEGLEALQLLSCLNLSHNKLGSFMALDPLRFLKSLRIL 606 >ref|XP_020213155.1| geranylgeranyl transferase type-2 subunit alpha 1 [Cajanus cajan] Length = 691 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NK GSFTAL PL+LLKSLKVL Sbjct: 563 GLEAMQLLSCLNLSHNKFGSFTALGPLRLLKSLKVL 598 >gb|KHN08985.1| Geranylgeranyl transferase type-2 subunit alpha [Glycine soja] Length = 691 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NK GSFTAL+P++LLKSLKVL Sbjct: 563 GLEAMQLLSCLNLSHNKFGSFTALEPVRLLKSLKVL 598 >ref|XP_003526554.1| PREDICTED: uncharacterized protein LOC100783193 [Glycine max] gb|KRH52963.1| hypothetical protein GLYMA_06G097500 [Glycine max] Length = 691 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NK GSFTAL+P++LLKSLKVL Sbjct: 563 GLEAMQLLSCLNLSHNKFGSFTALEPVRLLKSLKVL 598 >gb|KYP71655.1| Geranylgeranyl transferase type-2 subunit alpha [Cajanus cajan] Length = 710 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 110 GLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 GLEAMQLL+CLNLS+NK GSFTAL PL+LLKSLKVL Sbjct: 582 GLEAMQLLSCLNLSHNKFGSFTALGPLRLLKSLKVL 617 >ref|XP_023750490.1| geranylgeranyl transferase type-2 subunit alpha 1 [Lactuca sativa] gb|PLY95544.1| hypothetical protein LSAT_6X106460 [Lactuca sativa] Length = 685 Score = 62.8 bits (151), Expect = 2e-07 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 125 MHLFTGLEAMQLLACLNLSNNKLGSFTALDPLKLLKSLKVL 3 +H GLEA+QLL+CLNLS+NKL SFTAL+PL+ LKSLKVL Sbjct: 550 LHSIEGLEALQLLSCLNLSHNKLTSFTALEPLRFLKSLKVL 590