BLASTX nr result
ID: Acanthopanax24_contig00020414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00020414 (804 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018818986.1| PREDICTED: uncharacterized protein LOC108989... 56 1e-06 ref|XP_018813475.1| PREDICTED: uncharacterized protein LOC108985... 55 5e-06 gb|OMO80084.1| hypothetical protein COLO4_24249 [Corchorus olito... 55 6e-06 >ref|XP_018818986.1| PREDICTED: uncharacterized protein LOC108989720 [Juglans regia] Length = 107 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +1 Query: 133 MGFAEKPLQMEGAGG-ESEVKKWVIAGIPLRSPLKPIFT 246 MGF+ K LQ++ GG ES+ KKWVIAGIPLR+PLKPI+T Sbjct: 1 MGFSGKALQLQADGGLESDGKKWVIAGIPLRAPLKPIYT 39 >ref|XP_018813475.1| PREDICTED: uncharacterized protein LOC108985584 [Juglans regia] Length = 105 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 133 MGFAEKPLQMEGAGGESEVKKWVIAGIPLRSPLKPIFTKSP 255 MGF+EK LQ +G G E++ KKWVIAGIPLR+PLK I+T P Sbjct: 1 MGFSEKALQADG-GLENDGKKWVIAGIPLRAPLKQIYTSFP 40 >gb|OMO80084.1| hypothetical protein COLO4_24249 [Corchorus olitorius] Length = 117 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 133 MGFAEKPLQMEGAGGESE-VKKWVIAGIPLRSPLKPIFTKSP 255 MG + KP Q+EG G ESE KKWVIAGIPLR+PLKP++T +P Sbjct: 1 MGVSGKP-QVEGGGLESEGAKKWVIAGIPLRAPLKPLYTTNP 41