BLASTX nr result
ID: Acanthopanax24_contig00020094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00020094 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POF19698.1| hypothetical protein CFP56_30593 [Quercus suber] 55 4e-07 >gb|POF19698.1| hypothetical protein CFP56_30593 [Quercus suber] Length = 117 Score = 55.5 bits (132), Expect = 4e-07 Identities = 28/59 (47%), Positives = 37/59 (62%) Frame = -3 Query: 412 NISGHEIECSSNSSMSYGLHDSLHQWATLTCRQPDYQICDIARMDQMDDIYLYKRNFWD 236 N +G E + S SSM GL + W T + QPD Q+ D+A +QM+DI+LYKRN WD Sbjct: 60 NFNG-EKDQSCGSSMCEGLSEECFNWRTNSRDQPDCQLNDLAGFEQMNDIFLYKRNLWD 117