BLASTX nr result
ID: Acanthopanax24_contig00020010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00020010 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016483428.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-10 gb|OIT37963.1| hypothetical protein A4A49_32635 [Nicotiana atten... 65 1e-09 ref|XP_004251130.1| PREDICTED: yrdC domain-containing protein, m... 64 3e-09 gb|PHT35160.1| hypothetical protein CQW23_26960 [Capsicum baccatum] 64 4e-09 ref|XP_016548466.1| PREDICTED: yrdC domain-containing protein, m... 64 4e-09 ref|XP_015058661.1| PREDICTED: yrdC domain-containing protein, m... 64 4e-09 ref|XP_009798167.1| PREDICTED: yrdC domain-containing protein, m... 64 4e-09 ref|XP_006340160.1| PREDICTED: yrdC domain-containing protein, m... 64 4e-09 ref|XP_004251129.1| PREDICTED: yrdC domain-containing protein, m... 64 4e-09 ref|XP_016548465.1| PREDICTED: yrdC domain-containing protein, m... 64 5e-09 ref|XP_023926748.1| yrdC domain-containing protein, mitochondria... 62 5e-09 ref|XP_016473381.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_009798166.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_016473379.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_009798165.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_006340159.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_016548464.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_016451757.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_015058660.1| PREDICTED: yrdC domain-containing protein, m... 64 6e-09 ref|XP_019262234.1| PREDICTED: yrdC domain-containing protein, m... 63 8e-09 >ref|XP_016483428.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like, partial [Nicotiana tabacum] Length = 126 Score = 63.5 bits (153), Expect = 6e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 89 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 124 >gb|OIT37963.1| hypothetical protein A4A49_32635 [Nicotiana attenuata] Length = 232 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSAEEET+A+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAEEETVAILERHSLLEDGT 230 >ref|XP_004251130.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X2 [Solanum lycopersicum] Length = 232 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EETIA+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAKEETIAILERHSLLEDGT 230 >gb|PHT35160.1| hypothetical protein CQW23_26960 [Capsicum baccatum] Length = 232 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 230 >ref|XP_016548466.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X3 [Capsicum annuum] ref|XP_016548467.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X3 [Capsicum annuum] Length = 232 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 195 VVDLTELGKYKILRPGSAKEETVAILERHSLLEDGT 230 >ref|XP_015058661.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X2 [Solanum pennellii] Length = 232 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 230 >ref|XP_009798167.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X3 [Nicotiana sylvestris] ref|XP_009798168.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X3 [Nicotiana sylvestris] ref|XP_009798169.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X3 [Nicotiana sylvestris] Length = 232 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 230 >ref|XP_006340160.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X2 [Solanum tuberosum] Length = 232 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 195 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 230 >ref|XP_004251129.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X1 [Solanum lycopersicum] Length = 281 Score = 63.9 bits (154), Expect = 4e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EETIA+L+RHSLLED T Sbjct: 244 VVDLTKLGKYKILRPGSAKEETIAILERHSLLEDGT 279 >ref|XP_016548465.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X2 [Capsicum annuum] Length = 263 Score = 63.5 bits (153), Expect = 5e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 226 VVDLTELGKYKILRPGSAKEETVAILERHSLLEDGT 261 >ref|XP_023926748.1| yrdC domain-containing protein, mitochondrial-like isoform X2 [Quercus suber] Length = 189 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDETVT 356 VVDLT +GKYKILRPGSA+EET+++L+RHSLLE+ T T Sbjct: 152 VVDLTRLGKYKILRPGSAKEETVSILERHSLLEEVTAT 189 >ref|XP_016473381.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like isoform X2 [Nicotiana tabacum] Length = 278 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 241 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 276 >ref|XP_009798166.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 278 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 241 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 276 >ref|XP_016473379.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like isoform X1 [Nicotiana tabacum] ref|XP_016473380.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like isoform X1 [Nicotiana tabacum] Length = 280 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 243 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 278 >ref|XP_009798165.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 280 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 243 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 278 >ref|XP_006340159.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X1 [Solanum tuberosum] Length = 280 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 243 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 278 >ref|XP_016548464.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X1 [Capsicum annuum] gb|PHT69293.1| hypothetical protein T459_28780 [Capsicum annuum] Length = 281 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 244 VVDLTELGKYKILRPGSAKEETVAILERHSLLEDGT 279 >ref|XP_016451757.1| PREDICTED: yrdC domain-containing protein, mitochondrial-like [Nicotiana tabacum] Length = 281 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 244 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 279 >ref|XP_015058660.1| PREDICTED: yrdC domain-containing protein, mitochondrial isoform X1 [Solanum pennellii] Length = 281 Score = 63.5 bits (153), Expect = 6e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSA+EET+A+L+RHSLLED T Sbjct: 244 VVDLTKLGKYKILRPGSAKEETVAILERHSLLEDGT 279 >ref|XP_019262234.1| PREDICTED: yrdC domain-containing protein, mitochondrial [Nicotiana attenuata] Length = 280 Score = 63.2 bits (152), Expect = 8e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 469 VVDLTSIGKYKILRPGSAEEETIAVLQRHSLLEDET 362 VVDLT +GKYKILRPGSAEEET+A+L+RH LLED T Sbjct: 243 VVDLTKLGKYKILRPGSAEEETVAILERHCLLEDGT 278