BLASTX nr result
ID: Acanthopanax24_contig00019464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00019464 (984 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMT18040.1| hypothetical protein BVRB_2g032330 [Beta vulgaris... 49 6e-06 dbj|BAT82536.1| hypothetical protein VIGAN_03256700 [Vigna angul... 46 9e-06 >gb|KMT18040.1| hypothetical protein BVRB_2g032330 [Beta vulgaris subsp. vulgaris] Length = 333 Score = 48.5 bits (114), Expect(2) = 6e-06 Identities = 22/40 (55%), Positives = 34/40 (85%) Frame = +3 Query: 408 VEDVLYHQKDVYKPLQQDKPKDINDAEWKILDRKALATVR 527 +ED+LY QK++Y+PL + KP +I +A+WK+LDR+A+A VR Sbjct: 23 IEDILY-QKNLYQPLSE-KPAEIEEAKWKVLDRQAVAVVR 60 Score = 31.2 bits (69), Expect(2) = 6e-06 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 358 EDGKLRIEKFNEQKFAWWKM 417 ED K+RIEKF+ F +WKM Sbjct: 2 EDSKIRIEKFDGTDFGYWKM 21 >dbj|BAT82536.1| hypothetical protein VIGAN_03256700 [Vigna angularis var. angularis] Length = 369 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 19/40 (47%), Positives = 30/40 (75%) Frame = +3 Query: 408 VEDVLYHQKDVYKPLQQDKPKDINDAEWKILDRKALATVR 527 +ED LY QK +Y PL+ +KP D+ ++W++LDR+AL +R Sbjct: 135 IEDYLY-QKKLYLPLRGEKPNDMEQSDWELLDRQALGVIR 173 Score = 33.1 bits (74), Expect(2) = 9e-06 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = +1 Query: 346 GAMA-EDGKLRIEKFNEQKFAWWKM 417 GAMA E+GK++IEKF+ F +WKM Sbjct: 109 GAMALEEGKVKIEKFDGSDFGFWKM 133