BLASTX nr result
ID: Acanthopanax24_contig00019277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00019277 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO76309.1| hypothetical protein CISIN_1g005058mg [Citrus sin... 75 8e-13 ref|XP_024045025.1| homeobox protein BEL1 homolog isoform X2 [Ci... 75 9e-13 gb|KDO76305.1| hypothetical protein CISIN_1g005058mg [Citrus sin... 75 9e-13 gb|PNT53707.1| hypothetical protein POPTR_001G100800v3 [Populus ... 75 9e-13 gb|PNT53708.1| hypothetical protein POPTR_001G100800v3 [Populus ... 75 9e-13 ref|XP_002299516.2| hypothetical protein POPTR_0001s09720g [Popu... 75 9e-13 ref|XP_006476516.1| PREDICTED: homeobox protein BEL1 homolog [Ci... 75 9e-13 ref|XP_006439494.1| homeobox protein BEL1 homolog isoform X1 [Ci... 75 9e-13 gb|KDO76303.1| hypothetical protein CISIN_1g005058mg [Citrus sin... 75 9e-13 ref|XP_011029331.1| PREDICTED: homeobox protein BEL1 homolog [Po... 74 2e-12 ref|XP_012086840.1| homeobox protein BEL1 homolog [Jatropha curc... 74 2e-12 ref|XP_021296798.1| homeobox protein BEL1 homolog [Herrania umbr... 73 4e-12 ref|XP_007040323.2| PREDICTED: homeobox protein BEL1 homolog [Th... 73 4e-12 gb|EOY24823.1| POX family protein isoform 1 [Theobroma cacao] >g... 73 4e-12 gb|PPR86732.1| hypothetical protein GOBAR_AA33960 [Gossypium bar... 68 5e-12 ref|XP_023914141.1| homeobox protein BEL1 homolog [Quercus suber... 73 5e-12 ref|XP_006385769.1| hypothetical protein POPTR_0003s13120g [Popu... 72 1e-11 ref|XP_011022632.1| PREDICTED: homeobox protein BEL1 homolog [Po... 72 1e-11 dbj|GAY39159.1| hypothetical protein CUMW_042220 [Citrus unshiu]... 72 1e-11 dbj|GAV76115.1| Homeobox_KN domain-containing protein/POX domain... 72 1e-11 >gb|KDO76309.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] gb|KDO76310.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] Length = 635 Score = 75.1 bits (183), Expect = 8e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 600 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 634 >ref|XP_024045025.1| homeobox protein BEL1 homolog isoform X2 [Citrus clementina] Length = 655 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 620 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 654 >gb|KDO76305.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] gb|KDO76306.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] gb|KDO76307.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] Length = 655 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 620 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 654 >gb|PNT53707.1| hypothetical protein POPTR_001G100800v3 [Populus trichocarpa] Length = 657 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 622 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 656 >gb|PNT53708.1| hypothetical protein POPTR_001G100800v3 [Populus trichocarpa] Length = 663 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 628 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 662 >ref|XP_002299516.2| hypothetical protein POPTR_0001s09720g [Populus trichocarpa] Length = 663 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 628 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 662 >ref|XP_006476516.1| PREDICTED: homeobox protein BEL1 homolog [Citrus sinensis] Length = 690 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 655 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 689 >ref|XP_006439494.1| homeobox protein BEL1 homolog isoform X1 [Citrus clementina] gb|ESR52734.1| hypothetical protein CICLE_v10019130mg [Citrus clementina] Length = 690 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 655 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 689 >gb|KDO76303.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] gb|KDO76304.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis] Length = 716 Score = 75.1 bits (183), Expect = 9e-13 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 681 HIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 715 >ref|XP_011029331.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica] Length = 658 Score = 74.3 bits (181), Expect = 2e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYS+LDGEGQNLPYRNLMGAQLLHDLA Sbjct: 623 HIEDCQQVQYSILDGEGQNLPYRNLMGAQLLHDLA 657 >ref|XP_012086840.1| homeobox protein BEL1 homolog [Jatropha curcas] gb|KDP25399.1| hypothetical protein JCGZ_20555 [Jatropha curcas] Length = 690 Score = 73.9 bits (180), Expect = 2e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HI++CQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 655 HIDDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 689 >ref|XP_021296798.1| homeobox protein BEL1 homolog [Herrania umbratica] ref|XP_021296802.1| homeobox protein BEL1 homolog [Herrania umbratica] Length = 661 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQ+LPYRNLMGAQLLHDLA Sbjct: 626 HIEDCQQVQYSLLDGEGQHLPYRNLMGAQLLHDLA 660 >ref|XP_007040323.2| PREDICTED: homeobox protein BEL1 homolog [Theobroma cacao] ref|XP_007040324.2| PREDICTED: homeobox protein BEL1 homolog [Theobroma cacao] Length = 661 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQ+LPYRNLMGAQLLHDLA Sbjct: 626 HIEDCQQVQYSLLDGEGQHLPYRNLMGAQLLHDLA 660 >gb|EOY24823.1| POX family protein isoform 1 [Theobroma cacao] gb|EOY24824.1| POX family protein isoform 1 [Theobroma cacao] gb|EOY24825.1| POX family protein isoform 1 [Theobroma cacao] gb|EOY24826.1| POX family protein isoform 1 [Theobroma cacao] gb|EOY24827.1| POX family protein isoform 1 [Theobroma cacao] Length = 661 Score = 73.2 bits (178), Expect = 4e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQ+LPYRNLMGAQLLHDLA Sbjct: 626 HIEDCQQVQYSLLDGEGQHLPYRNLMGAQLLHDLA 660 >gb|PPR86732.1| hypothetical protein GOBAR_AA33960 [Gossypium barbadense] Length = 90 Score = 67.8 bits (164), Expect = 5e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 6 IEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 IE+CQ VQYSLLDGEGQ+LPYRNLMGAQLLHDLA Sbjct: 56 IEDCQPVQYSLLDGEGQHLPYRNLMGAQLLHDLA 89 >ref|XP_023914141.1| homeobox protein BEL1 homolog [Quercus suber] gb|POF08557.1| homeobox protein bel1 like [Quercus suber] Length = 684 Score = 72.8 bits (177), Expect = 5e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQ VQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 649 HIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLA 683 >ref|XP_006385769.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa] ref|XP_006385771.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa] ref|XP_006385773.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa] gb|PNT45331.1| hypothetical protein POPTR_003G131300v3 [Populus trichocarpa] gb|PNT45333.1| hypothetical protein POPTR_003G131300v3 [Populus trichocarpa] gb|PNT45335.1| hypothetical protein POPTR_003G131300v3 [Populus trichocarpa] Length = 664 Score = 72.0 bits (175), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQ VQYSLLDGEGQNLPYRNLMGAQLLHD+A Sbjct: 629 HIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDMA 663 >ref|XP_011022632.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica] Length = 665 Score = 72.0 bits (175), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQ VQYSLLDGEGQNLPYRNLMGAQLLHD+A Sbjct: 630 HIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDMA 664 >dbj|GAY39159.1| hypothetical protein CUMW_042220 [Citrus unshiu] dbj|GAY39160.1| hypothetical protein CUMW_042220 [Citrus unshiu] Length = 690 Score = 72.0 bits (175), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 HIE+CQQVQYSLLDGEGQNLPYRNLM AQLLHDLA Sbjct: 655 HIEDCQQVQYSLLDGEGQNLPYRNLMEAQLLHDLA 689 >dbj|GAV76115.1| Homeobox_KN domain-containing protein/POX domain-containing protein [Cephalotus follicularis] Length = 671 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 3 HIEECQQVQYSLLDGEGQNLPYRNLMGAQLLHDLA 107 H+E+CQ VQYSLLDGEGQNLPYRNLMGAQLLHDLA Sbjct: 636 HMEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLA 670