BLASTX nr result
ID: Acanthopanax24_contig00018675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00018675 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON48770.1| Pseudouridine synthase [Parasponia andersonii] 65 3e-09 gb|PON83943.1| Pseudouridine synthase [Trema orientalis] 65 3e-09 ref|XP_020220948.1| uncharacterized protein LOC109803675 isoform... 64 5e-09 ref|XP_006598748.1| PREDICTED: uncharacterized protein LOC100799... 64 7e-09 ref|XP_003592926.2| tRNA pseudouridine synthase A [Medicago trun... 63 1e-08 ref|XP_020220947.1| uncharacterized protein LOC109803675 isoform... 63 1e-08 ref|XP_020220946.1| uncharacterized protein LOC109803675 isoform... 63 1e-08 gb|KRH26319.1| hypothetical protein GLYMA_12G167000 [Glycine max] 62 2e-08 ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-lik... 62 2e-08 gb|KHN39669.1| tRNA pseudouridine synthase A [Glycine soja] >gi|... 62 2e-08 ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycin... 62 2e-08 ref|XP_016470665.1| PREDICTED: tRNA pseudouridine synthase A-lik... 62 4e-08 ref|XP_016470664.1| PREDICTED: tRNA pseudouridine synthase A-lik... 62 4e-08 ref|XP_009596426.1| PREDICTED: uncharacterized protein LOC104092... 62 4e-08 ref|XP_019267169.1| PREDICTED: uncharacterized protein LOC109244... 62 4e-08 ref|XP_012066663.1| uncharacterized protein LOC105629658 isoform... 61 4e-08 ref|XP_012066662.1| uncharacterized protein LOC105629658 isoform... 61 5e-08 ref|XP_019424639.1| PREDICTED: uncharacterized protein LOC109333... 61 5e-08 ref|XP_023731264.1| uncharacterized protein LOC111879019 [Lactuc... 61 5e-08 gb|OIV91520.1| hypothetical protein TanjilG_08932 [Lupinus angus... 61 6e-08 >gb|PON48770.1| Pseudouridine synthase [Parasponia andersonii] Length = 350 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEELDLPAMQ Sbjct: 174 YFYRLLSGPEPLSTFEKDRAWHVPEELDLPAMQ 206 >gb|PON83943.1| Pseudouridine synthase [Trema orientalis] Length = 351 Score = 64.7 bits (156), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEELDLPAMQ Sbjct: 175 YFYRLLSGPEPLSTFEKDRAWHVPEELDLPAMQ 207 >ref|XP_020220948.1| uncharacterized protein LOC109803675 isoform X3 [Cajanus cajan] Length = 346 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQVQEEV 352 YFYRLLSGPE +STFEKDRA HVPEEL+LPAMQ + + Sbjct: 170 YFYRLLSGPEPLSTFEKDRAWHVPEELNLPAMQAKSPI 207 >ref|XP_006598748.1| PREDICTED: uncharacterized protein LOC100799818 isoform X1 [Glycine max] gb|KRH06071.1| hypothetical protein GLYMA_16G003100 [Glycine max] Length = 349 Score = 63.5 bits (153), Expect = 7e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQVQEEV 352 YFYRLLSGPE +STFEKDRA HVPEEL LPAMQ + + Sbjct: 172 YFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQAKSPI 209 >ref|XP_003592926.2| tRNA pseudouridine synthase A [Medicago truncatula] gb|ABE79574.2| tRNA pseudouridine synthase [Medicago truncatula] gb|AES63177.2| tRNA pseudouridine synthase A [Medicago truncatula] Length = 361 Score = 63.2 bits (152), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE++STFEKDRA H+PEEL+LPAMQ Sbjct: 164 YFYRLLSGPETLSTFEKDRAWHIPEELNLPAMQ 196 >ref|XP_020220947.1| uncharacterized protein LOC109803675 isoform X2 [Cajanus cajan] Length = 366 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL+LPAMQ Sbjct: 169 YFYRLLSGPEPLSTFEKDRAWHVPEELNLPAMQ 201 >ref|XP_020220946.1| uncharacterized protein LOC109803675 isoform X1 [Cajanus cajan] gb|KYP63212.1| tRNA pseudouridine synthase A [Cajanus cajan] Length = 367 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL+LPAMQ Sbjct: 170 YFYRLLSGPEPLSTFEKDRAWHVPEELNLPAMQ 202 >gb|KRH26319.1| hypothetical protein GLYMA_12G167000 [Glycine max] Length = 368 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL LPAMQ Sbjct: 170 YFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQ 202 >ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-like [Glycine max] gb|KHN31590.1| tRNA pseudouridine synthase A [Glycine soja] gb|KRH26320.1| hypothetical protein GLYMA_12G167000 [Glycine max] Length = 369 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL LPAMQ Sbjct: 171 YFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQ 203 >gb|KHN39669.1| tRNA pseudouridine synthase A [Glycine soja] gb|KRH06072.1| hypothetical protein GLYMA_16G003100 [Glycine max] Length = 370 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL LPAMQ Sbjct: 172 YFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQ 204 >ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycine max] gb|ACU18919.1| unknown [Glycine max] Length = 370 Score = 62.4 bits (150), Expect = 2e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEEL LPAMQ Sbjct: 172 YFYRLLSGPEPLSTFEKDRAWHVPEELSLPAMQ 204 >ref|XP_016470665.1| PREDICTED: tRNA pseudouridine synthase A-like isoform X3 [Nicotiana tabacum] Length = 369 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE VS+FEKDRA HVPE LDLPAMQ Sbjct: 168 YFYRLLSGPEWVSSFEKDRAWHVPESLDLPAMQ 200 >ref|XP_016470664.1| PREDICTED: tRNA pseudouridine synthase A-like isoform X2 [Nicotiana tabacum] Length = 386 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE VS+FEKDRA HVPE LDLPAMQ Sbjct: 186 YFYRLLSGPEWVSSFEKDRAWHVPESLDLPAMQ 218 >ref|XP_009596426.1| PREDICTED: uncharacterized protein LOC104092518 [Nicotiana tomentosiformis] ref|XP_016470663.1| PREDICTED: tRNA pseudouridine synthase A-like isoform X1 [Nicotiana tabacum] Length = 387 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE VS+FEKDRA HVPE LDLPAMQ Sbjct: 186 YFYRLLSGPEWVSSFEKDRAWHVPESLDLPAMQ 218 >ref|XP_019267169.1| PREDICTED: uncharacterized protein LOC109244518 [Nicotiana attenuata] gb|OIT05626.1| hypothetical protein A4A49_18305 [Nicotiana attenuata] Length = 390 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE VS+FEKDRA HVPE LDLPAMQ Sbjct: 189 YFYRLLSGPEWVSSFEKDRAWHVPESLDLPAMQ 221 >ref|XP_012066663.1| uncharacterized protein LOC105629658 isoform X2 [Jatropha curcas] Length = 324 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEELDL AMQ Sbjct: 159 YFYRLLSGPEPLSTFEKDRAWHVPEELDLVAMQ 191 >ref|XP_012066662.1| uncharacterized protein LOC105629658 isoform X1 [Jatropha curcas] Length = 342 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPE +STFEKDRA HVPEELDL AMQ Sbjct: 177 YFYRLLSGPEPLSTFEKDRAWHVPEELDLVAMQ 209 >ref|XP_019424639.1| PREDICTED: uncharacterized protein LOC109333586 [Lupinus angustifolius] Length = 361 Score = 61.2 bits (147), Expect = 5e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPES+STFEKDRA HVPEEL+L AMQ Sbjct: 164 YFYRLLSGPESLSTFEKDRAWHVPEELNLRAMQ 196 >ref|XP_023731264.1| uncharacterized protein LOC111879019 [Lactuca sativa] gb|PLY75857.1| hypothetical protein LSAT_9X120240 [Lactuca sativa] Length = 363 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYR+LSGPE +STFEK RA HVPEELDLPAMQ Sbjct: 175 YFYRILSGPEHLSTFEKGRAWHVPEELDLPAMQ 207 >gb|OIV91520.1| hypothetical protein TanjilG_08932 [Lupinus angustifolius] Length = 776 Score = 61.2 bits (147), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 239 YFYRLLSGPESVSTFEKDRASHVPEELDLPAMQ 337 YFYRLLSGPES+STFEKDRA HVPEEL+L AMQ Sbjct: 602 YFYRLLSGPESLSTFEKDRAWHVPEELNLRAMQ 634