BLASTX nr result
ID: Acanthopanax24_contig00017731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00017731 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017255513.1| PREDICTED: HVA22-like protein k [Daucus caro... 64 3e-09 >ref|XP_017255513.1| PREDICTED: HVA22-like protein k [Daucus carota subsp. sativus] gb|KZM90534.1| hypothetical protein DCAR_022101 [Daucus carota subsp. sativus] Length = 191 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 1 IGTKIIVLGNQIVRDIIHPVQRPASGMIEAPPRPEETTDSDHEE 132 IGTKI+V N IVRDII+P Q PA+ IEAPPRP+E ++SDH+E Sbjct: 148 IGTKIMVSANHIVRDIIYPNQNPANSTIEAPPRPDEASNSDHDE 191