BLASTX nr result
ID: Acanthopanax24_contig00017382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00017382 (636 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017229550.1| PREDICTED: protein MEI2-like 5 [Daucus carot... 60 5e-07 >ref|XP_017229550.1| PREDICTED: protein MEI2-like 5 [Daucus carota subsp. sativus] Length = 858 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = -1 Query: 636 HSEGSEADDQLVQEPLPSNSLNIQTSHSKRPVLDSGDSPGSTTKDSAGEVSSLEK 472 H+EG E DQ+ +EPL S SLN+Q + SK P DS + PGST KD A E S +EK Sbjct: 803 HAEGPEVGDQVSEEPLTSGSLNVQIARSKLPGSDSREPPGSTAKDGAEESSFVEK 857