BLASTX nr result
ID: Acanthopanax24_contig00017278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00017278 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019170054.1| PREDICTED: B-cell receptor-associated protei... 113 5e-28 dbj|GAV73217.1| Bap31 domain-containing protein [Cephalotus foll... 112 1e-27 ref|XP_018836308.1| PREDICTED: uncharacterized protein LOC109002... 111 4e-27 ref|XP_017231599.1| PREDICTED: uncharacterized protein LOC108205... 111 4e-27 ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protei... 108 5e-27 gb|KZN11572.1| hypothetical protein DCAR_004228 [Daucus carota s... 110 5e-27 ref|XP_017238951.1| PREDICTED: B-cell receptor-associated protei... 110 7e-27 ref|XP_008440020.1| PREDICTED: uncharacterized protein LOC103484... 110 8e-27 ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protei... 110 1e-26 ref|XP_016467612.1| PREDICTED: B-cell receptor-associated protei... 108 3e-26 ref|XP_023517818.1| B-cell receptor-associated protein 31-like [... 108 4e-26 ref|XP_022926894.1| B-cell receptor-associated protein 31-like [... 108 4e-26 ref|XP_019257200.1| PREDICTED: B-cell receptor-associated protei... 108 4e-26 gb|KZV37186.1| B-cell receptor-associated protein 31-like [Dorco... 108 6e-26 ref|XP_011096040.1| B-cell receptor-associated protein 31 [Sesam... 108 6e-26 gb|PHU25073.1| hypothetical protein BC332_03405 [Capsicum chinense] 108 6e-26 ref|XP_016557830.1| PREDICTED: B-cell receptor-associated protei... 108 6e-26 ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protei... 107 9e-26 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus cl... 107 9e-26 ref|XP_022142340.1| B-cell receptor-associated protein 31 [Momor... 107 1e-25 >ref|XP_019170054.1| PREDICTED: B-cell receptor-associated protein 31-like [Ipomoea nil] Length = 223 Score = 113 bits (283), Expect = 5e-28 Identities = 61/111 (54%), Positives = 77/111 (69%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELR+RRK MEAVKKQ+R ++GK G+SEEI++LEE+A++LRE+ K+LESE+ Sbjct: 112 YIRELRMRRKTMEAVKKQNRAIDEGKAGISEEIKSLEEQASSLRERIKQLESEVEEKSKE 171 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR+LSHSD KKV Sbjct: 172 ASSSEANAIALKKQSEGFLLEYDRLLEENQHLRSQLQSLDRKLSHSDSKKV 222 >dbj|GAV73217.1| Bap31 domain-containing protein [Cephalotus follicularis] Length = 221 Score = 112 bits (280), Expect = 1e-27 Identities = 65/110 (59%), Positives = 69/110 (62%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 +IRELRIRRK MEAVKKQSR FEDGK G SEE++ LEEE TTLR K KELESEL Sbjct: 110 FIRELRIRRKSMEAVKKQSRGFEDGKAGSSEELKGLEEELTTLRAKLKELESELQTKTKD 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEGFL EYD S+DRRLS S KK Sbjct: 170 VNATEANAVALRKQSEGFLYEYDRLQEENQNLRHQLHSLDRRLSRSGSKK 219 >ref|XP_018836308.1| PREDICTED: uncharacterized protein LOC109002851 [Juglans regia] Length = 221 Score = 111 bits (277), Expect = 4e-27 Identities = 66/110 (60%), Positives = 71/110 (64%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRK MEAVKKQ+R EDGK G SEEI+AL+EE TL+ K KELESEL Sbjct: 110 YIRELRIRRKSMEAVKKQTRGPEDGKAGGSEEIKALKEETATLQAKLKELESELETRTKE 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEGFLLEYD QS+DRRLSHS KK Sbjct: 170 VHAADANAVALRKQSEGFLLEYDRLLEENQNLRNQLQSLDRRLSHSGSKK 219 >ref|XP_017231599.1| PREDICTED: uncharacterized protein LOC108205974 [Daucus carota subsp. sativus] gb|KZN07328.1| hypothetical protein DCAR_008165 [Daucus carota subsp. sativus] Length = 223 Score = 111 bits (277), Expect = 4e-27 Identities = 67/113 (59%), Positives = 75/113 (66%), Gaps = 1/113 (0%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDG-KVGVSEEIRALEEEATTLREKFKELESELXXXXX 354 YIRELRIRRKGMEAVKKQ+R FED K G S+EI+ALE+EA LREK+K+L+SEL Sbjct: 111 YIRELRIRRKGMEAVKKQNRGFEDVIKAGGSDEIKALEDEAVMLREKYKKLQSELEAKTK 170 Query: 353 XXXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKVM 195 AL+KQSEGFLLEYD QSVDR LSHS KKVM Sbjct: 171 EANVAEANAVALKKQSEGFLLEYDRLLEDNQNLRNQLQSVDRTLSHSGSKKVM 223 >ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial [Nicotiana sylvestris] Length = 150 Score = 108 bits (271), Expect = 5e-27 Identities = 63/111 (56%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL +RRK MEAV+KQ+R FEDGK G SEEI+ LEEEA+ LR K K+LESEL Sbjct: 39 YIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRGKIKQLESELQVKAKE 98 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR LS SD KKV Sbjct: 99 ASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKV 149 >gb|KZN11572.1| hypothetical protein DCAR_004228 [Daucus carota subsp. sativus] Length = 208 Score = 110 bits (275), Expect = 5e-27 Identities = 66/112 (58%), Positives = 73/112 (65%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRKGME +KKQ+RVFED K G EE +ALE+EA LREKFK+L+SEL Sbjct: 99 YIRELRIRRKGMEVIKKQNRVFEDVKAG--EERKALEDEAVMLREKFKKLQSELEAKTKE 156 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKVM 195 A+RKQSEGFLLEYD QS DRRLSHS KKVM Sbjct: 157 AKNAESNAIAMRKQSEGFLLEYDRLLEDNQNLRNQLQSADRRLSHSGIKKVM 208 >ref|XP_017238951.1| PREDICTED: B-cell receptor-associated protein 31-like [Daucus carota subsp. sativus] Length = 220 Score = 110 bits (275), Expect = 7e-27 Identities = 66/112 (58%), Positives = 73/112 (65%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRKGME +KKQ+RVFED K G EE +ALE+EA LREKFK+L+SEL Sbjct: 111 YIRELRIRRKGMEVIKKQNRVFEDVKAG--EERKALEDEAVMLREKFKKLQSELEAKTKE 168 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKVM 195 A+RKQSEGFLLEYD QS DRRLSHS KKVM Sbjct: 169 AKNAESNAIAMRKQSEGFLLEYDRLLEDNQNLRNQLQSADRRLSHSGIKKVM 220 >ref|XP_008440020.1| PREDICTED: uncharacterized protein LOC103484623 [Cucumis melo] Length = 221 Score = 110 bits (275), Expect = 8e-27 Identities = 64/110 (58%), Positives = 70/110 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 Y+RELR+RRKGMEA+KKQSR EDGKV SEEI+ALEEE TTL K K+LESEL Sbjct: 110 YMRELRLRRKGMEAIKKQSRALEDGKVSKSEEIKALEEERTTLETKLKQLESELDSKTKD 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEG LLEYD QSV+RRLS S KK Sbjct: 170 VTASEANVVALRKQSEGLLLEYDRLLEENQNLRGQLQSVERRLSRSGSKK 219 >ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis] ref|XP_016432706.1| PREDICTED: B-cell receptor-associated protein 31-like [Nicotiana tabacum] Length = 222 Score = 110 bits (274), Expect = 1e-26 Identities = 64/111 (57%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL +RRK MEAVKKQ+R FEDGK G SEEI+ LEEEA+ LR K K+LESEL Sbjct: 111 YIRELSMRRKTMEAVKKQNRAFEDGKSGASEEIKTLEEEASALRGKIKQLESELQEKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR LS SD KKV Sbjct: 171 ASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKV 221 >ref|XP_016467612.1| PREDICTED: B-cell receptor-associated protein 31-like [Nicotiana tabacum] Length = 222 Score = 108 bits (271), Expect = 3e-26 Identities = 63/111 (56%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL +RRK MEAV+KQ+R FEDGK G SEEI+ LEEEA+ LR K K+LESEL Sbjct: 111 YIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRGKIKQLESELQVKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR LS SD KKV Sbjct: 171 ASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKV 221 >ref|XP_023517818.1| B-cell receptor-associated protein 31-like [Cucurbita pepo subsp. pepo] Length = 221 Score = 108 bits (270), Expect = 4e-26 Identities = 62/110 (56%), Positives = 70/110 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 Y+RELR+RRKGMEA+KKQSRV EDGKV SEEI+ALEEE TTL+ + K+LE EL Sbjct: 110 YMRELRLRRKGMEAIKKQSRVMEDGKVSKSEEIKALEEEGTTLQTRLKQLELELDSKTKD 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEG LLEYD QS+D RLS S KK Sbjct: 170 ITTSEANVVALRKQSEGLLLEYDRLLEENQNLRSQIQSIDHRLSRSGSKK 219 >ref|XP_022926894.1| B-cell receptor-associated protein 31-like [Cucurbita moschata] ref|XP_023003449.1| B-cell receptor-associated protein 31-like [Cucurbita maxima] Length = 221 Score = 108 bits (270), Expect = 4e-26 Identities = 62/110 (56%), Positives = 70/110 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 Y+RELR+RRKGMEA+KKQSRV EDGKV SEEI+ALEEE TTL+ + K+LE EL Sbjct: 110 YMRELRLRRKGMEAIKKQSRVMEDGKVSKSEEIKALEEEGTTLQTRLKQLELELDSKTKD 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEG LLEYD QS+D RLS S KK Sbjct: 170 ITTSEANVVALRKQSEGLLLEYDRLLEENQNLRSQIQSIDHRLSRSGSKK 219 >ref|XP_019257200.1| PREDICTED: B-cell receptor-associated protein 31-like [Nicotiana attenuata] gb|OIS96137.1| hypothetical protein A4A49_21760 [Nicotiana attenuata] Length = 222 Score = 108 bits (270), Expect = 4e-26 Identities = 63/111 (56%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL +RRK MEAVKKQ+R FEDGK G SEEI+ LEEEA+ LR K K+LES+L Sbjct: 111 YIRELSMRRKTMEAVKKQNRAFEDGKSGASEEIKTLEEEASALRGKIKKLESQLQEKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR LS SD KKV Sbjct: 171 ASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKV 221 >gb|KZV37186.1| B-cell receptor-associated protein 31-like [Dorcoceras hygrometricum] Length = 221 Score = 108 bits (269), Expect = 6e-26 Identities = 62/112 (55%), Positives = 74/112 (66%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRK MEAVKKQSR FEDGK VSEEI+ALE E ++L ++ ++LES L Sbjct: 110 YIRELRIRRKTMEAVKKQSRNFEDGKPPVSEEIKALEAETSSLHKRIQQLESHLEEKSKE 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKVM 195 AL+KQSEGFLLEYD QS+DRRLSHS+ KK++ Sbjct: 170 ASSAEANAIALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRRLSHSNSKKII 221 >ref|XP_011096040.1| B-cell receptor-associated protein 31 [Sesamum indicum] Length = 221 Score = 108 bits (269), Expect = 6e-26 Identities = 63/112 (56%), Positives = 72/112 (64%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRK MEAVKKQSRVFED K +EEI+ALEEE LR + K+LE++L Sbjct: 110 YIRELRIRRKTMEAVKKQSRVFEDSKPPATEEIKALEEETIALRGRIKDLETQLEEKNKE 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKVM 195 AL+KQSEGFLLEYD QS+DR+ S SDGKKVM Sbjct: 170 SGSAEANAMALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRKFSLSDGKKVM 221 >gb|PHU25073.1| hypothetical protein BC332_03405 [Capsicum chinense] Length = 222 Score = 108 bits (269), Expect = 6e-26 Identities = 63/111 (56%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL IRRK MEAVKKQSR FEDGK G SEEI+ LE EA+ LR K ++LESEL Sbjct: 111 YIRELSIRRKTMEAVKKQSRAFEDGKSGASEEIKTLEGEASALRGKIRQLESELVEKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR+LS S+ KKV Sbjct: 171 ASSAEANAGALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRKLSRSESKKV 221 >ref|XP_016557830.1| PREDICTED: B-cell receptor-associated protein 31-like [Capsicum annuum] gb|PHT89133.1| hypothetical protein T459_04246 [Capsicum annuum] Length = 222 Score = 108 bits (269), Expect = 6e-26 Identities = 63/111 (56%), Positives = 71/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL IRRK MEAVKKQ+R FEDGK G SEEI+ LE EA+ LR K ++LESEL Sbjct: 111 YIRELSIRRKTMEAVKKQNRAFEDGKSGASEEIKTLEGEASALRGKIRQLESELVEKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 ALRKQSEGFLLEYD QS+DR+LS S+ KKV Sbjct: 171 ASSAEANAGALRKQSEGFLLEYDRLLEENQNLRSQLQSLDRKLSRSESKKV 221 >ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum tuberosum] Length = 222 Score = 107 bits (268), Expect = 9e-26 Identities = 63/111 (56%), Positives = 70/111 (63%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIREL IRRK MEAVKKQ+R FEDGK G SEEI+ LE EA+ LREK ++LE EL Sbjct: 111 YIRELSIRRKTMEAVKKQNRAFEDGKSGASEEIKTLEGEASALREKIRQLELELEEKAKE 170 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKKV 198 AL+KQSEGFLLEYD QS+DR LS SD KKV Sbjct: 171 ASSAEANAGALKKQSEGFLLEYDRLLEENQNLRSQLQSLDRTLSRSDSKKV 221 >gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina] dbj|GAY35232.1| hypothetical protein CUMW_015100 [Citrus unshiu] Length = 223 Score = 107 bits (268), Expect = 9e-26 Identities = 63/110 (57%), Positives = 69/110 (62%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 YIRELRIRRK MEA+K QSR FEDGK SEEI+ALE++ TTL+ K KELESEL Sbjct: 112 YIRELRIRRKTMEAIKNQSRGFEDGKAAGSEEIKALEDQMTTLKSKLKELESELETKSKE 171 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEGFL EYD QS+D RLSHS KK Sbjct: 172 ANAAETNAVALRKQSEGFLFEYDRLLEENQNLRNQLQSLDWRLSHSGSKK 221 >ref|XP_022142340.1| B-cell receptor-associated protein 31 [Momordica charantia] Length = 221 Score = 107 bits (267), Expect = 1e-25 Identities = 63/110 (57%), Positives = 69/110 (62%) Frame = -2 Query: 530 YIRELRIRRKGMEAVKKQSRVFEDGKVGVSEEIRALEEEATTLREKFKELESELXXXXXX 351 Y+RELRIRRKGME +KKQSR+ EDGKV SEEI+ALEEE TTL+ K K+LE EL Sbjct: 110 YMRELRIRRKGMETIKKQSRMVEDGKVSKSEEIKALEEERTTLQTKLKQLELELETKTKD 169 Query: 350 XXXXXXXXXALRKQSEGFLLEYDXXXXXXXXXXXXXQSVDRRLSHSDGKK 201 ALRKQSEG LLEYD QSVD RLS S KK Sbjct: 170 ISTSEANVVALRKQSEGLLLEYDRLLEENQNLRGQLQSVDHRLSRSGSKK 219