BLASTX nr result
ID: Acanthopanax24_contig00017031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00017031 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OWM62595.1| hypothetical protein CDL15_Pgr000020 [Punica gran... 62 9e-10 gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] 61 5e-09 gb|AVL84887.1| cytochrome c oxidase subunit 2 (mitochondrion) [G... 60 1e-07 ref|YP_717172.1| cytochrome c oxidase subunit 2 [Brassica napus]... 58 6e-07 sp|P93285.2|COX2_ARATH RecName: Full=Cytochrome c oxidase subuni... 58 6e-07 emb|CBI36501.3| unnamed protein product, partial [Vitis vinifera] 56 2e-06 ref|YP_009270661.1| cytochrome c oxidase subunit 2 (mitochondrio... 56 3e-06 ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrio... 56 3e-06 gb|AAB88906.1| cytochrome c oxidase subunit II (mitochondrion) [... 56 3e-06 gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) ... 56 3e-06 gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [G... 56 3e-06 dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Ni... 56 3e-06 ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgari... 56 3e-06 >gb|OWM62595.1| hypothetical protein CDL15_Pgr000020 [Punica granatum] Length = 74 Score = 61.6 bits (148), Expect = 9e-10 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = -2 Query: 177 KLWLPTDPIIGEIQSLRFAPGLETVSQAP---SPLGSEKASSKLKKPFPLSLI 28 KLWLPTD IIGEIQSLRFAPGLETVSQAP SE+ + K PF L+ Sbjct: 2 KLWLPTDLIIGEIQSLRFAPGLETVSQAPFASRKRESEQQAEKALSPFSKLLV 54 Score = 55.5 bits (132), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 94 PFASRKRESEQQAEKALSPFSNNKVSFIAPT 2 PFASRKRESEQQAEKALSPFS VSFIAPT Sbjct: 30 PFASRKRESEQQAEKALSPFSKLLVSFIAPT 60 >gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 60.8 bits (146), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 GWSYEAYLIIRERGKGFFSLLLAFSLPRGEGA 97 GWSYEAYLII +R KGFFSLLLAFSLPRGEG+ Sbjct: 58 GWSYEAYLIIMKRRKGFFSLLLAFSLPRGEGS 89 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 34 RKGKGLFQLAARFLASERRRGLTYGFQAWREAKGLDFTYDRISGQ 168 ++ KG F L F LTYGFQAWR+AKGLDFTYD+ISGQ Sbjct: 69 KRRKGFFSLLLAFSLPRGEGSLTYGFQAWRKAKGLDFTYDQISGQ 113 >gb|AVL84887.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gastrodia elata] Length = 305 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 355 TNLTPIYRRRSCF*ERLWFLGIQSINPPNRGSLSGN 462 + LTPIYRRRSC ERLWF GIQSI+PPNRGS S N Sbjct: 266 SGLTPIYRRRSCSFERLWFSGIQSIHPPNRGSWSVN 301 >ref|YP_717172.1| cytochrome c oxidase subunit 2 [Brassica napus] dbj|BAC98922.1| cytochrome c oxidase subunit 2 (mitochondrion) [Brassica napus] Length = 260 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 +SIVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MSIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >sp|P93285.2|COX2_ARATH RecName: Full=Cytochrome c oxidase subunit 2; AltName: Full=Cytochrome c oxidase polypeptide II Length = 260 Score = 57.8 bits (138), Expect = 6e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 +SIVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MSIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >emb|CBI36501.3| unnamed protein product, partial [Vitis vinifera] Length = 274 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = +1 Query: 1 RLEL*SLPYY*RKGKG-LFQLAARFLASERRRGLTYGFQAWREAKGLDFTYDRISGQ 168 RLEL P KG+ +F+ F + LTYGFQAWRE KGLDFTYD+ISGQ Sbjct: 217 RLELCLTPLLLEKGERVIFRGLLAFSLPKGEGSLTYGFQAWREVKGLDFTYDQISGQ 273 >ref|YP_009270661.1| cytochrome c oxidase subunit 2 (mitochondrion) [Nelumbo nucifera] gb|ALL55114.1| cytochrome c oxidase subunit 2 (mitochondrion) [Nelumbo nucifera] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >ref|YP_006665990.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] gb|AAB88867.1| cytochrome c oxidase subunit II (mitochondrion) [Raphanus sativus] dbj|BAM36189.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] dbj|BAM36232.1| cytochrome c oxidase subunit 2 (mitochondrion) [Raphanus sativus] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >gb|AAB88906.1| cytochrome c oxidase subunit II (mitochondrion) [Brassica rapa subsp. oleifera] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >gb|AEX57640.1| cytochrome c oxidase subunit 2-1 (mitochondrion) [Raphanus sativus] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >gb|AFZ85273.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gb|AFZ85274.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] gb|AFZ85275.1| cytochrome c oxidase subunit 2 (mitochondrion) [Gossypium hirsutum] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >dbj|BAD83476.2| cytochrome oxidase subunit 2 (mitochondrion) [Nicotiana tabacum] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260 >ref|NP_064061.2| cox2 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] ref|YP_004222256.1| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842063.1| cytochrome c oxidase subunit 2 (mitochondrion) [Beta macrocarpa] gb|ABD36067.1| cytochrome oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. vulgaris] dbj|BAA99453.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. vulgaris] emb|CBJ14086.1| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ17495.1| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX24868.1| cytochrome c oxidase subunit 2 (mitochondrion) [Beta macrocarpa] emb|CBL52062.2| cytochrome c oxidase subunit 2 (mitochondrion) [Beta vulgaris subsp. maritima] Length = 260 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 368 LSIVVEAVSRKDYGSWVSNQLIPQTGEA 451 + IVVEAVSRKDYGSWVSNQLIPQTGEA Sbjct: 233 MPIVVEAVSRKDYGSWVSNQLIPQTGEA 260