BLASTX nr result
ID: Acanthopanax24_contig00016693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00016693 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017223569.1| PREDICTED: protein ABCI12, chloroplastic iso... 56 2e-06 >ref|XP_017223569.1| PREDICTED: protein ABCI12, chloroplastic isoform X1 [Daucus carota subsp. sativus] gb|KZM85438.1| hypothetical protein DCAR_027140 [Daucus carota subsp. sativus] Length = 373 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 438 QAMNVRGFRGDSNSHNIYFSFETSNGMANIVS 343 QAMNVRGFRGDSN+HNIYFS +SN MANI+S Sbjct: 324 QAMNVRGFRGDSNTHNIYFSSLSSNSMANILS 355