BLASTX nr result
ID: Acanthopanax24_contig00016295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00016295 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB16936.1| hypothetical protein B456_002G255500 [Gossypium r... 60 3e-08 gb|KJB16938.1| hypothetical protein B456_002G255500 [Gossypium r... 60 6e-08 ref|XP_018715596.1| PREDICTED: probable proteasome inhibitor iso... 58 7e-08 gb|PPE00100.1| hypothetical protein GOBAR_DD02890 [Gossypium bar... 60 8e-08 gb|KJB16939.1| hypothetical protein B456_002G255500 [Gossypium r... 60 8e-08 ref|XP_017619751.1| PREDICTED: probable proteasome inhibitor [Go... 60 8e-08 ref|XP_016749122.1| PREDICTED: probable proteasome inhibitor [Go... 60 8e-08 ref|XP_012468391.1| PREDICTED: probable proteasome inhibitor [Go... 60 8e-08 gb|KHG27906.1| hypothetical protein F383_01469 [Gossypium arboreum] 60 8e-08 ref|XP_018715595.1| PREDICTED: probable proteasome inhibitor iso... 58 1e-07 ref|XP_018715594.1| PREDICTED: probable proteasome inhibitor iso... 58 1e-07 ref|XP_018715592.1| PREDICTED: probable proteasome inhibitor iso... 58 1e-07 ref|XP_022036063.1| probable proteasome inhibitor [Helianthus an... 57 1e-06 ref|XP_020600016.1| probable proteasome inhibitor isoform X1 [Ph... 56 2e-06 ref|XP_011094928.1| probable proteasome inhibitor [Sesamum indicum] 56 3e-06 gb|PON90777.1| PI31 proteasome regulator [Trema orientalis] 56 3e-06 gb|PON59939.1| PI31 proteasome regulator [Parasponia andersonii] 56 3e-06 ref|XP_010037783.1| PREDICTED: probable proteasome inhibitor [Eu... 55 3e-06 ref|XP_024194564.1| probable proteasome inhibitor [Rosa chinensi... 55 5e-06 ref|XP_020692818.1| probable proteasome inhibitor isoform X2 [De... 55 5e-06 >gb|KJB16936.1| hypothetical protein B456_002G255500 [Gossypium raimondii] Length = 190 Score = 60.1 bits (144), Expect = 3e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 158 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 190 >gb|KJB16938.1| hypothetical protein B456_002G255500 [Gossypium raimondii] Length = 250 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 218 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 250 >ref|XP_018715596.1| PREDICTED: probable proteasome inhibitor isoform X4 [Eucalyptus grandis] Length = 141 Score = 58.2 bits (139), Expect = 7e-08 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP+RF R N RRPGGGTHPDLEHFRD +DFI Sbjct: 109 PGFEPSRFVR-NPRRPGGGTHPDLEHFRDVSDFI 141 >gb|PPE00100.1| hypothetical protein GOBAR_DD02890 [Gossypium barbadense] Length = 294 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 262 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 294 >gb|KJB16939.1| hypothetical protein B456_002G255500 [Gossypium raimondii] Length = 299 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 267 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 299 >ref|XP_017619751.1| PREDICTED: probable proteasome inhibitor [Gossypium arboreum] Length = 301 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 269 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 301 >ref|XP_016749122.1| PREDICTED: probable proteasome inhibitor [Gossypium hirsutum] Length = 301 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 269 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 301 >ref|XP_012468391.1| PREDICTED: probable proteasome inhibitor [Gossypium raimondii] gb|KJB16935.1| hypothetical protein B456_002G255500 [Gossypium raimondii] Length = 301 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 269 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 301 >gb|KHG27906.1| hypothetical protein F383_01469 [Gossypium arboreum] Length = 301 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R RRPGGGTHPDLEHF DFI Sbjct: 269 PGFEPNRFIRNPPRRPGGGTHPDLEHFGGGDFI 301 >ref|XP_018715595.1| PREDICTED: probable proteasome inhibitor isoform X3 [Eucalyptus grandis] Length = 161 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP+RF R N RRPGGGTHPDLEHFRD +DFI Sbjct: 129 PGFEPSRFVR-NPRRPGGGTHPDLEHFRDVSDFI 161 >ref|XP_018715594.1| PREDICTED: probable proteasome inhibitor isoform X2 [Eucalyptus grandis] Length = 170 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP+RF R N RRPGGGTHPDLEHFRD +DFI Sbjct: 138 PGFEPSRFVR-NPRRPGGGTHPDLEHFRDVSDFI 170 >ref|XP_018715592.1| PREDICTED: probable proteasome inhibitor isoform X1 [Eucalyptus grandis] ref|XP_018715593.1| PREDICTED: probable proteasome inhibitor isoform X1 [Eucalyptus grandis] Length = 171 Score = 58.2 bits (139), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP+RF R N RRPGGGTHPDLEHFRD +DFI Sbjct: 139 PGFEPSRFVR-NPRRPGGGTHPDLEHFRDVSDFI 171 >ref|XP_022036063.1| probable proteasome inhibitor [Helianthus annuus] gb|OTG29639.1| putative proteasome inhibitor-related protein [Helianthus annuus] Length = 302 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEPNRF R N RRP GGTHPDLEHF +DFI Sbjct: 271 PGFEPNRFAR-NPRRPPGGTHPDLEHFNGSDFI 302 >ref|XP_020600016.1| probable proteasome inhibitor isoform X1 [Phalaenopsis equestris] Length = 302 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEP RF R+ RRPGGGTHPDLEHF +DFI Sbjct: 271 PGFEPQRFVRQP-RRPGGGTHPDLEHFHGSDFI 302 >ref|XP_011094928.1| probable proteasome inhibitor [Sesamum indicum] Length = 300 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP RF R N RRPGGGTHPDLEHF D +DFI Sbjct: 268 PGFEPGRFVR-NPRRPGGGTHPDLEHFHDGSDFI 300 >gb|PON90777.1| PI31 proteasome regulator [Trema orientalis] Length = 302 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHF-RDNDFI 101 PGFEPNRFTR RRPG GTHPDLEHF +DFI Sbjct: 269 PGFEPNRFTRAPPRRPGSGTHPDLEHFGSGSDFI 302 >gb|PON59939.1| PI31 proteasome regulator [Parasponia andersonii] Length = 302 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHF-RDNDFI 101 PGFEPNRFTR RRPG GTHPDLEHF +DFI Sbjct: 269 PGFEPNRFTRTPPRRPGSGTHPDLEHFGSGSDFI 302 >ref|XP_010037783.1| PREDICTED: probable proteasome inhibitor [Eucalyptus grandis] gb|KCW49518.1| hypothetical protein EUGRSUZ_K03043 [Eucalyptus grandis] Length = 304 Score = 55.5 bits (132), Expect = 3e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRD-NDFI 101 PGFEP RF R N RRPG GTHPDLEHFRD +DFI Sbjct: 272 PGFEPGRFVR-NPRRPGSGTHPDLEHFRDGSDFI 304 >ref|XP_024194564.1| probable proteasome inhibitor [Rosa chinensis] gb|PRQ37812.1| putative PI31 proteasome regulator [Rosa chinensis] Length = 290 Score = 55.1 bits (131), Expect = 5e-06 Identities = 27/34 (79%), Positives = 28/34 (82%), Gaps = 1/34 (2%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHF-RDNDFI 101 PGFEPNRF R N RRPGGGTHPDLEHF +DFI Sbjct: 258 PGFEPNRFAR-NPRRPGGGTHPDLEHFGSGSDFI 290 >ref|XP_020692818.1| probable proteasome inhibitor isoform X2 [Dendrobium catenatum] Length = 300 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 3 PGFEPNRFTRRNLRRPGGGTHPDLEHFRDNDFI 101 PGFEP RF RR RRPGGG HPDLEHF+ +D+I Sbjct: 269 PGFEPQRFVRRP-RRPGGGVHPDLEHFQGSDYI 300