BLASTX nr result
ID: Acanthopanax24_contig00016105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00016105 (686 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN01073.1| hypothetical protein DCAR_009827 [Daucus carota s... 58 1e-09 >gb|KZN01073.1| hypothetical protein DCAR_009827 [Daucus carota subsp. sativus] Length = 140 Score = 57.8 bits (138), Expect(2) = 1e-09 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = +2 Query: 191 IVCGCGMVAPMWEVWKDGTLDLGRRFVGYNRYK 289 I C CG+VAP WE WKDGTLD GRRF G +RYK Sbjct: 17 IKCRCGIVAPCWEAWKDGTLDPGRRFYGCSRYK 49 Score = 33.5 bits (75), Expect(2) = 1e-09 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 376 QDKNMYCGIFKWCDPPFTERSRKVIKKIEGRI 471 +D C F+W +P F+ER+R+VI +++ ++ Sbjct: 49 KDPGRSCNFFQWAEPAFSERAREVIHELKMKV 80