BLASTX nr result
ID: Acanthopanax24_contig00015909
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00015909 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlise... 95 8e-23 gb|EFH63110.1| hypothetical protein ARALYDRAFT_893949 [Arabidops... 68 4e-12 gb|ASI10370.1| photosystem II protein L, partial (chloroplast) [... 55 8e-08 gb|ASD40472.1| photosystem II protein L, partial (chloroplast) [... 55 8e-08 gb|ASD42234.1| photosystem II protein L, partial (chloroplast) [... 55 8e-08 gb|AFU94384.1| PsbL, partial (chloroplast) [Schistostemon retusu... 55 8e-08 gb|APH08545.1| PSII reaction centre subunit XII (chloroplast) [A... 55 8e-08 gb|AER53240.1| photosystem II protein L, partial (plastid) [Ascl... 55 8e-08 gb|AFU94352.1| PsbL, partial (chloroplast) [Bergia texana] 55 8e-08 ref|YP_009141551.1| photosystem II protein L (chloroplast) [Lens... 55 9e-08 gb|AFU94350.1| PsbL, partial (chloroplast) [Averrhoa carambola] ... 55 9e-08 gb|AEX65383.1| photosystem II reaction center protein L, partial... 55 9e-08 gb|ASD44511.1| photosystem II protein L (chloroplast) [Secale ce... 55 9e-08 ref|YP_009379928.1| photosystem II protein L (chloroplast) [Dacr... 55 9e-08 ref|YP_009239211.1| photosystem II protein L (chloroplast) [Pedi... 55 9e-08 gb|AAQ09351.2| photosystem II subunit L (chloroplast) [Widdringt... 55 9e-08 gb|AKR80948.1| photosystem II protein L (plastid) [Lophiola aurea] 55 9e-08 ref|YP_398344.1| photosystem II protein L [Lactuca sativa] >gi|9... 55 9e-08 ref|YP_001312218.1| photosystem II protein L [Cycas taitungensis... 55 9e-08 ref|YP_009109076.1| photosystem II protein L (plastid) [Corallor... 55 9e-08 >gb|EPS74273.1| hypothetical protein M569_00483, partial [Genlisea aurea] Length = 81 Score = 95.1 bits (235), Expect = 8e-23 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +3 Query: 225 SGVNG*YYWKDSSLDNRYCNWYSCDWFNRYFFLWFIFRIGFIPVVI 362 SG+NG +YWKDSSLDNRYCNWYSCDW NRYF LW IFRI FIPVVI Sbjct: 1 SGINGRHYWKDSSLDNRYCNWYSCDWLNRYFLLWVIFRIRFIPVVI 46 >gb|EFH63110.1| hypothetical protein ARALYDRAFT_893949 [Arabidopsis lyrata subsp. lyrata] Length = 85 Score = 67.8 bits (164), Expect = 4e-12 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 258 SSLDNRYCNWYSCDWFNRYFFLWFIFRIGFIPVVI 362 SSL NRYC+WYSCD FNRYF LWFIFRI FIPV I Sbjct: 50 SSLGNRYCSWYSCDRFNRYFLLWFIFRIRFIPVEI 84 >gb|ASI10370.1| photosystem II protein L, partial (chloroplast) [Aegilops juvenalis] Length = 31 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|ASD40472.1| photosystem II protein L, partial (chloroplast) [Australopyrum retrofractum] Length = 32 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|ASD42234.1| photosystem II protein L, partial (chloroplast) [Heteranthelium piliferum] Length = 33 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 26 >gb|AFU94384.1| PsbL, partial (chloroplast) [Schistostemon retusum] gb|ASD45137.1| photosystem II protein L, partial (chloroplast) [Taeniatherum caput-medusae] gb|ASH99623.1| photosystem II protein L, partial (chloroplast) [Aegilops uniaristata] Length = 33 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|APH08545.1| PSII reaction centre subunit XII (chloroplast) [Amaranthus tricolor] Length = 34 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|AER53240.1| photosystem II protein L, partial (plastid) [Asclepias subaphylla] gb|AFU94369.1| PsbL, partial (chloroplast) [Irvingia malayana] Length = 34 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 2 PNEQNVELNRTSLYWGLLLIFVLAVL 27 >gb|AFU94352.1| PsbL, partial (chloroplast) [Bergia texana] Length = 36 Score = 55.5 bits (132), Expect = 8e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_009141551.1| photosystem II protein L (chloroplast) [Lens culinaris] ref|YP_009295119.1| photosystem II protein L (chloroplast) [Ipomoea nil] gb|AIL56077.1| photosystem II protein L (chloroplast) [Lens culinaris] dbj|BAV56649.1| photosystem II protein L (chloroplast) [Ipomoea nil] Length = 37 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 5 PNEQNVELNRTSLYWGLLLIFVLAVL 30 >gb|AFU94350.1| PsbL, partial (chloroplast) [Averrhoa carambola] gb|AFU94359.1| PsbL, partial (chloroplast) [Elaeodendron orientale] Length = 37 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 5 PNEQNVELNRTSLYWGLLLIFVLAVL 30 >gb|AEX65383.1| photosystem II reaction center protein L, partial (chloroplast) [Portulacaria afra] Length = 37 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|ASD44511.1| photosystem II protein L (chloroplast) [Secale cereale] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_009379928.1| photosystem II protein L (chloroplast) [Dacrycarpus imbricatus] dbj|BAX56456.1| photosystem II protein L (chloroplast) [Dacrycarpus imbricatus] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_009239211.1| photosystem II protein L (chloroplast) [Pedicularis ishidoyana] ref|YP_009269576.1| photosystem II protein L (chloroplast) [Cephalanthera longifolia] ref|YP_009270060.1| photosystem II protein L (chloroplast) [Listera fugongensis] ref|YP_009269662.1| photosystem II protein L (chloroplast) [Epipactis mairei] ref|YP_009269742.1| photosystem II protein L (plastid) [Cephalanthera humilis] ref|YP_009269858.1| photosystem II protein L (chloroplast) [Epipactis veratrifolia] ref|YP_009269974.1| photosystem II protein L (chloroplast) [Neottia pinetorum] ref|YP_009270146.1| photosystem II protein L (chloroplast) [Neottia ovata] ref|YP_009462544.1| photosystem II protein L (chloroplast) [Boehmeria spicata] ref|YP_009462643.1| photosystem II protein L (chloroplast) [Boehmeria umbrosa] gb|AML80540.1| photosystem II protein L (chloroplast) [Pedicularis ishidoyana] gb|ANT72484.1| photosystem II protein L (chloroplast) [Cephalanthera longifolia] gb|ANT72573.1| photosystem II protein L (chloroplast) [Epipactis mairei] gb|ANT72651.1| photosystem II protein L (plastid) [Cephalanthera humilis] gb|ANT72767.1| photosystem II protein L (chloroplast) [Epipactis veratrifolia] gb|ANT72883.1| photosystem II protein L (chloroplast) [Neottia pinetorum] gb|ANT72968.1| photosystem II protein L (chloroplast) [Listera fugongensis] gb|ANT73054.1| photosystem II protein L (chloroplast) [Neottia ovata] gb|AUV64945.1| photosystem II protein L (chloroplast) [Boehmeria spicata] gb|AUV65045.1| photosystem II protein L (chloroplast) [Boehmeria umbrosa] gb|AVM10636.1| photosystem II protein L (chloroplast) [Epipactis mairei] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|AAQ09351.2| photosystem II subunit L (chloroplast) [Widdringtonia cedarbergensis] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >gb|AKR80948.1| photosystem II protein L (plastid) [Lophiola aurea] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_398344.1| photosystem II protein L [Lactuca sativa] ref|YP_567091.1| photosystem II protein L (chloroplast) [Vitis vinifera] ref|YP_008563103.1| photosystem II protein L, partial (chloroplast) [Solanum lycopersicum] ref|YP_009019806.1| photosystem II protein L (chloroplast) [Vitis rotundifolia] ref|YP_009128196.1| photosystem II protein L (chloroplast) [Saracha punctata] ref|YP_009128854.1| photosystem II protein L (chloroplast) [Iochroma loxense] ref|YP_009123647.1| photosystem II protein L (chloroplast) [Iochroma stenanthum] ref|YP_009123172.1| photosystem II protein L (chloroplast) [Dunalia obovata] ref|YP_009123366.1| photosystem II protein L (chloroplast) [Iochroma nitidum] ref|YP_009132767.1| photosystem II protein L (chloroplast) [Dunalia brachyacantha] ref|YP_009123088.1| photosystem II protein L (chloroplast) [Cannabis sativa] ref|YP_009142341.1| photosystem II protein L (chloroplast) [Iochroma tingoanum] ref|YP_009389774.1| photosystem II protein L (chloroplast) [Silene capitata] ref|YP_009454073.1| photosystem II protein L (chloroplast) [Vachellia seyal] ref|YP_009454155.1| photosystem II protein L (chloroplast) [Senegalia laeta] emb|CAA50030.1| psbL, partial (chloroplast) [Spinacia oleracea] emb|CAA77418.1| PSII L-protein, partial (chloroplast) [Nicotiana tabacum] emb|CAA46540.1| 3.2kDa polypeptide from photosystem II (chloroplast) [Capsicum annuum] dbj|BAE47609.1| photosystem II protein L, partial (chloroplast) [Lactuca sativa] gb|ABC56228.1| photosystem II protein L, partial (chloroplast) [Solanum bulbocastanum] gb|ABC56315.1| photosystem II protein L, partial (chloroplast) [Solanum lycopersicum] gb|ABD47072.1| photosystem II protein L, partial (chloroplast) [Solanum tuberosum] gb|ABE47549.1| photosystem II protein L, partial (chloroplast) [Vitis vinifera] gb|ABU85668.1| photosystem II protein L, partial (chloroplast) [Trachelium caeruleum] gb|ACH47480.1| photosystem II protein L, partial (chloroplast) [Erodium chrysanthum] gb|ACH47481.1| photosystem II protein L, partial (chloroplast) [Erodium texanum] gb|ACH47482.1| photosystem II protein L, partial (chloroplast) [Geranium carolinianum] gb|ACH47486.1| photosystem II protein L, partial (chloroplast) [Monsonia vanderietiae] gb|ACH47487.1| photosystem II protein L, partial (chloroplast) [Pelargonium cotyledonis] gb|ADM92711.1| photosystem II protein L, partial (chloroplast) [Davidia involucrata] gb|AEB72240.1| photosystem II protein L (chloroplast) [Solanum tuberosum] gb|AEX65377.1| photosystem II reaction center protein L, partial (chloroplast) [Anredera baselloides] gb|AEX65379.1| photosystem II reaction center protein L, partial (chloroplast) [Didierea madagascariensis] gb|AEX65380.1| photosystem II reaction center protein L, partial (chloroplast) [Maihuenia poeppigii] gb|AEX65381.1| photosystem II reaction center protein L, partial (chloroplast) [Mollugo verticillata] gb|AEX65382.1| photosystem II reaction center protein L, partial (chloroplast) [Opuntia decumbens] gb|AEX65384.1| photosystem II reaction center protein L, partial (chloroplast) [Pereskiopsis diguetii] gb|AEX65385.1| photosystem II reaction center protein L, partial (chloroplast) [Portulaca oleracea] gb|AEX65386.1| photosystem II reaction center protein L, partial (chloroplast) [Weingartia kargliana] dbj|BAO01507.1| photosystem II protein L, partial (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01591.1| photosystem II protein L, partial (chloroplast) [Vitis vinifera subsp. caucasica] dbj|BAO01675.1| photosystem II protein L, partial (chloroplast) [Vitis vinifera subsp. caucasica] gb|AHJ91224.1| photosystem II protein L (chloroplast) [Vitis rotundifolia] gb|AJK91437.1| photosystem II protein L (chloroplast) [Cannabis sativa] gb|AJL34424.1| photosystem II protein L (chloroplast) [Dunalia obovata] gb|AJM70115.1| photosystem II protein L (chloroplast) [Iochroma nitidum] gb|AJN90520.1| photosystem II protein L (chloroplast) [Iochroma stenanthum] gb|AJO61596.1| photosystem II protein L (chloroplast) [Saracha punctata] gb|AJS14268.1| photosystem II protein L (chloroplast) [Iochroma loxense] gb|AJS14354.1| photosystem II protein L (chloroplast) [Iochroma calycinum] gb|AKA66547.1| photosystem II protein L (chloroplast) [Dunalia brachyacantha] gb|AKH02334.1| photosystem II protein L (chloroplast) [Iochroma tingoanum] gb|ANG08202.1| photosystem II protein L (chloroplast) [Silene capitata] gb|ATO88878.1| photosystem II protein L (chloroplast) [Vachellia nilotica subsp. tomentosa] gb|ATO88960.1| photosystem II protein L (chloroplast) [Vachellia tortilis subsp. raddiana] gb|ATO89124.1| photosystem II protein L (chloroplast) [Vachellia seyal] gb|ATO89168.1| photosystem II protein L (chloroplast) [Faidherbia albida] gb|ATO89251.1| photosystem II protein L (chloroplast) [Senegalia laeta] gb|ATO89042.1| photosystem II protein L (chloroplast) [Vachellia tortilis subsp. raddiana] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_001312218.1| photosystem II protein L [Cycas taitungensis] ref|YP_005352722.1| psbL gene product (chloroplast) [Ginkgo biloba] ref|YP_007474639.1| photosystem II protein L (chloroplast) [Cycas revoluta] ref|YP_009113554.1| photosystem II protein L (chloroplast) [Bowenia serrulata] ref|YP_009113641.1| photosystem II protein L (chloroplast) [Ceratozamia hildae] ref|YP_009113742.1| photosystem II protein L (chloroplast) [Zamia furfuracea] ref|YP_009113837.1| photosystem II protein L (chloroplast) [Stangeria eriopus] ref|YP_009158357.1| photosystem II protein L (chloroplast) [Macrozamia mountperriensis] ref|YP_009158444.1| photosystem II protein L (chloroplast) [Dioon spinulosum] ref|YP_009158531.1| photosystem II protein L (chloroplast) [Lepidozamia peroffskyana] ref|YP_009158618.1| photosystem II protein L (chloroplast) [Encephalartos lehmannii] ref|YP_009308209.1| photosystem II protein L (chloroplast) [Cycas panzhihuaensis] sp|Q71L51.1|PSBL_STAER RecName: Full=Photosystem II reaction center protein L; Short=PSII-L sp|Q71L70.1|PSBL_CYCRE RecName: Full=Photosystem II reaction center protein L; Short=PSII-L sp|Q71L82.1|PSBL_BOWSE RecName: Full=Photosystem II reaction center protein L; Short=PSII-L sp|Q7IW42.1|PSBL_ZAMFU RecName: Full=Photosystem II reaction center protein L; Short=PSII-L sp|Q9THZ2.1|PSBL_GINBI RecName: Full=Photosystem II reaction center protein L; Short=PSII-L sp|A6H5J3.1|PSBL_CYCTA RecName: Full=Photosystem II reaction center protein L; Short=PSII-L emb|CAB61493.1| L-peptide (chloroplast) [Ginkgo biloba] gb|AAF73301.1| photosystem II subunit L (chloroplast) [Zamia furfuracea] gb|AAG26224.1| photosystem II subunit (chloroplast) [Ginkgo biloba] gb|AAQ05222.1| photosystem II subunit L (chloroplast) [Bowenia serrulata] gb|AAQ05230.1| photosystem II subunit L (chloroplast) [Ceratozamia miqueliana] gb|AAQ05234.1| photosystem II subunit L (chloroplast) [Cycas revoluta] gb|AAQ05238.1| photosystem II subunit L (chloroplast) [Dioon purpusii] gb|AAQ05242.1| photosystem II subunit L (chloroplast) [Encephalartos barteri] gb|AAQ05253.1| photosystem II subunit L (chloroplast) [Stangeria eriopus] gb|AAW21828.1| photosystem II subunit L (chloroplast) [Lepidozamia hopei] gb|AAW21832.1| photosystem II subunit L (chloroplast) [Macrozamia moorei] gb|AAZ04907.1| photosystem II protein L, partial (chloroplast) [Ginkgo biloba] dbj|BAF64959.1| photosystem II protein L (chloroplast) [Cycas taitungensis] gb|ABU85280.1| photosystem II protein L, partial (chloroplast) [Cycas micronesica] dbj|BAL03652.1| photosystem II protein L (chloroplast) [Bowenia serrulata] gb|AEQ37128.1| photosystem II protein L (chloroplast) [Ginkgo biloba] gb|AEX98435.1| photosystem II protein L (chloroplast) [Ginkgo biloba] gb|AEX98853.1| photosystem II protein L (chloroplast) [Ginkgo biloba] gb|AEX99020.1| photosystem II protein L (chloroplast) [Ginkgo biloba] gb|AEX99188.1| photosystem II protein L (chloroplast) [Cycas revoluta] dbj|BAL72607.1| photosystem II protein L (chloroplast) [Ginkgo biloba] gb|AFM54160.1| PsbL (chloroplast) [Ceratozamia hildae] gb|AFM54161.1| PsbL (chloroplast) [Zamia furfuracea] gb|AFR13732.1| photosystem II protein L (chloroplast) [Bowenia serrulata] gb|AFR13819.1| photosystem II protein L (chloroplast) [Ceratozamia hildae] gb|AFR45389.1| photosystem II protein L (chloroplast) [Zamia furfuracea] gb|AFR45485.1| photosystem II protein L (chloroplast) [Stangeria eriopus] gb|AFR53222.1| photosystem II protein L (chloroplast) [Encephalartos lehmannii] gb|AFR59404.1| photosystem II protein L (chloroplast) [Lepidozamia peroffskyana] gb|AFS64393.1| photosystem II protein L (chloroplast) [Macrozamia mountperriensis] gb|AFS64456.1| photosystem II protein L (chloroplast) [Dioon spinulosum] gb|AJD00264.1| photosystem II protein L (chloroplast) [Cycas debaoensis] gb|AJE71406.1| photosystem II protein L (plastid) [Ginkgo biloba] dbj|BAR93307.1| photosystem II protein L (chloroplast) [Zamia furfuracea] dbj|BAR93393.1| photosystem II protein L (chloroplast) [Stangeria eriopus] dbj|BAR93476.1| photosystem II protein L (chloroplast) [Ceratozamia hildae] dbj|BAR93563.1| photosystem II protein L (chloroplast) [Macrozamia mountperriensis] dbj|BAR93650.1| photosystem II protein L (chloroplast) [Dioon spinulosum] dbj|BAR93737.1| photosystem II protein L (chloroplast) [Lepidozamia peroffskyana] dbj|BAR93824.1| photosystem II protein L (chloroplast) [Encephalartos lehmannii] gb|AOS53158.1| photosystem II protein L (chloroplast) [Cycas panzhihuaensis] gb|AOW68801.1| photosystem II protein L (chloroplast) [Cycas debaoensis] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31 >ref|YP_009109076.1| photosystem II protein L (plastid) [Corallorhiza mertensiana] gb|AIW51545.1| photosystem II protein L (plastid) [Corallorhiza mertensiana] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 PNEQNVELNRTSLYWGLLLIFVLAVL 78 PNEQNVELNRTSLYWGLLLIFVLAVL Sbjct: 6 PNEQNVELNRTSLYWGLLLIFVLAVL 31