BLASTX nr result
ID: Acanthopanax24_contig00015517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00015517 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017215352.1| PREDICTED: probable inactive leucine-rich re... 60 2e-07 >ref|XP_017215352.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Daucus carota subsp. sativus] gb|KZM89144.1| hypothetical protein DCAR_026219 [Daucus carota subsp. sativus] Length = 745 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 3/37 (8%) Frame = -2 Query: 492 LNSSNRPSFEDVLWNLQYAAQIQ---DGDQRSETVQQ 391 LNSSNRPSFED+LWNLQYAAQIQ DGD R ET++Q Sbjct: 708 LNSSNRPSFEDILWNLQYAAQIQANADGDHRFETMEQ 744