BLASTX nr result
ID: Acanthopanax24_contig00015285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00015285 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017222577.1| PREDICTED: uncharacterized protein LOC108199... 61 6e-08 gb|KZM84292.1| hypothetical protein DCAR_028414 [Daucus carota s... 61 6e-08 ref|XP_019152964.1| PREDICTED: uncharacterized protein LOC109149... 55 8e-06 >ref|XP_017222577.1| PREDICTED: uncharacterized protein LOC108199319 [Daucus carota subsp. sativus] Length = 1005 Score = 61.2 bits (147), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAQQDPVSTVRVVDHFVIQQTEKSDMQSSNGQVT 102 S+QQDPVSTVRVVDHFVI+QTEK DM+SSNGQ++ Sbjct: 972 SSQQDPVSTVRVVDHFVIEQTEKFDMRSSNGQIS 1005 >gb|KZM84292.1| hypothetical protein DCAR_028414 [Daucus carota subsp. sativus] Length = 1285 Score = 61.2 bits (147), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 1 SAQQDPVSTVRVVDHFVIQQTEKSDMQSSNGQVT 102 S+QQDPVSTVRVVDHFVI+QTEK DM+SSNGQ++ Sbjct: 1252 SSQQDPVSTVRVVDHFVIEQTEKFDMRSSNGQIS 1285 >ref|XP_019152964.1| PREDICTED: uncharacterized protein LOC109149584 [Ipomoea nil] ref|XP_019152965.1| PREDICTED: uncharacterized protein LOC109149584 [Ipomoea nil] Length = 1018 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 SAQQDPVSTVRVVDHFVIQQTEKSDMQSSNGQVT 102 S QQDP++TVRVVDHFVI+QTEKSD +S NG T Sbjct: 984 SLQQDPINTVRVVDHFVIEQTEKSDSESMNGSKT 1017