BLASTX nr result
ID: Acanthopanax24_contig00014583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00014583 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN02597.1| hypothetical protein DCAR_011351 [Daucus carota s... 60 5e-09 gb|KZM97499.1| hypothetical protein DCAR_015139 [Daucus carota s... 52 6e-06 >gb|KZN02597.1| hypothetical protein DCAR_011351 [Daucus carota subsp. sativus] Length = 105 Score = 60.1 bits (144), Expect = 5e-09 Identities = 39/71 (54%), Positives = 46/71 (64%), Gaps = 5/71 (7%) Frame = +2 Query: 89 FFAILRRIRVTVKYFQNNNTNGGPHDKLPESFVPALETAVDPEP---VDVKFGDNS-VLD 256 FF IL R+R TVKY +NN K+ ES +PALE P+ VDVK GDN+ VLD Sbjct: 43 FFTILNRMRSTVKYLKNN--------KVGESIIPALEVPPPPDEEVVVDVKVGDNNCVLD 94 Query: 257 LNSIPD-GESN 286 LNSIPD GES+ Sbjct: 95 LNSIPDEGESD 105 >gb|KZM97499.1| hypothetical protein DCAR_015139 [Daucus carota subsp. sativus] Length = 118 Score = 52.4 bits (124), Expect = 6e-06 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +2 Query: 89 FFAILRRIRVTVKYFQNNNTNGGPHDKLPESFVPALETAVDPEP-VDVKFGD-NSVLDLN 262 FF IL R+RVT KY +++ + +D + PA E V E V+VK GD N VLDLN Sbjct: 51 FFTILNRMRVTAKYLKSSKSANANNDG--DVIFPATELPVLHEAKVEVKVGDANLVLDLN 108 Query: 263 SIPDGESNGE 292 S+PDGE N + Sbjct: 109 SLPDGEINSD 118