BLASTX nr result
ID: Acanthopanax24_contig00013626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00013626 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074751.1| cellulose synthase A catalytic subunit 2 [UD... 65 4e-09 gb|PIN01940.1| Cellulose synthase (GDP-forming) [Handroanthus im... 65 4e-09 gb|KZV16530.1| cell synthase A catalytic subunit 2 [Dorcoceras h... 65 5e-09 gb|KZN08614.1| hypothetical protein DCAR_001144 [Daucus carota s... 65 7e-09 ref|XP_017227287.1| PREDICTED: cellulose synthase A catalytic su... 65 7e-09 gb|KZN08613.1| hypothetical protein DCAR_001143 [Daucus carota s... 64 1e-08 ref|XP_022875256.1| cellulose synthase A catalytic subunit 2 [UD... 64 1e-08 ref|XP_017225983.1| PREDICTED: cellulose synthase A catalytic su... 64 1e-08 ref|XP_022875255.1| cellulose synthase A catalytic subunit 2 [UD... 64 1e-08 ref|XP_011101270.1| cellulose synthase A catalytic subunit 2 [UD... 64 2e-08 gb|APU87553.1| CesA9 [Plantago cunninghamii] 64 2e-08 ref|XP_022894296.1| cellulose synthase A catalytic subunit 2 [UD... 64 2e-08 gb|KZV58226.1| cell synthase A catalytic subunit 2 [Dorcoceras h... 63 2e-08 ref|XP_012080728.1| cellulose synthase A catalytic subunit 2 [UD... 62 5e-08 ref|XP_019153045.1| PREDICTED: cellulose synthase A catalytic su... 62 6e-08 ref|XP_019174455.1| PREDICTED: cellulose synthase A catalytic su... 62 6e-08 gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Ge... 62 7e-08 gb|KVH99583.1| Cellulose synthase [Cynara cardunculus var. scoly... 62 8e-08 ref|XP_022039721.1| cellulose synthase A catalytic subunit 5 [UD... 62 8e-08 ref|XP_022039720.1| cellulose synthase A catalytic subunit 5 [UD... 62 8e-08 >ref|XP_011074751.1| cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1092 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLSRDGIVLEVCGLDCD Sbjct: 1063 ASIFSLLWVRINPFLSRDGIVLEVCGLDCD 1092 >gb|PIN01940.1| Cellulose synthase (GDP-forming) [Handroanthus impetiginosus] Length = 1094 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLSRDGIVLEVCGLDCD Sbjct: 1065 ASIFSLLWVRINPFLSRDGIVLEVCGLDCD 1094 >gb|KZV16530.1| cell synthase A catalytic subunit 2 [Dorcoceras hygrometricum] Length = 1071 Score = 65.1 bits (157), Expect = 5e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLSRDGI+LEVCGLDCD Sbjct: 1042 ASIFSLLWVRINPFLSRDGIILEVCGLDCD 1071 >gb|KZN08614.1| hypothetical protein DCAR_001144 [Daucus carota subsp. sativus] Length = 1054 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPF+SRDGIVLEVCGLDCD Sbjct: 1025 ASIFSLLWVRVNPFVSRDGIVLEVCGLDCD 1054 >ref|XP_017227287.1| PREDICTED: cellulose synthase A catalytic subunit 5 [UDP-forming]-like isoform X1 [Daucus carota subsp. sativus] Length = 1096 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPF+SRDGIVLEVCGLDCD Sbjct: 1067 ASIFSLLWVRVNPFVSRDGIVLEVCGLDCD 1096 >gb|KZN08613.1| hypothetical protein DCAR_001143 [Daucus carota subsp. sativus] Length = 872 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDGIVLEVCGLDCD Sbjct: 843 ASIFSLLWVRINPFVSRDGIVLEVCGLDCD 872 >ref|XP_022875256.1| cellulose synthase A catalytic subunit 2 [UDP-forming]-like isoform X2 [Olea europaea var. sylvestris] Length = 1094 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLS+DGIVLEVCGLDCD Sbjct: 1065 ASIFSLLWVRINPFLSKDGIVLEVCGLDCD 1094 >ref|XP_017225983.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Daucus carota subsp. sativus] Length = 1094 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDGIVLEVCGLDCD Sbjct: 1065 ASIFSLLWVRINPFVSRDGIVLEVCGLDCD 1094 >ref|XP_022875255.1| cellulose synthase A catalytic subunit 2 [UDP-forming]-like isoform X1 [Olea europaea var. sylvestris] Length = 1100 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLS+DGIVLEVCGLDCD Sbjct: 1071 ASIFSLLWVRINPFLSKDGIVLEVCGLDCD 1100 >ref|XP_011101270.1| cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Sesamum indicum] Length = 1084 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDG+VLEVCGLDCD Sbjct: 1055 ASIFSLLWVRINPFVSRDGLVLEVCGLDCD 1084 >gb|APU87553.1| CesA9 [Plantago cunninghamii] Length = 1086 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDG+VLEVCGLDCD Sbjct: 1057 ASIFSLLWVRINPFVSRDGLVLEVCGLDCD 1086 >ref|XP_022894296.1| cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Olea europaea var. sylvestris] Length = 1093 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLSRDGIVLEVCGLDC+ Sbjct: 1064 ASIFSLLWVRINPFLSRDGIVLEVCGLDCN 1093 >gb|KZV58226.1| cell synthase A catalytic subunit 2 [Dorcoceras hygrometricum] Length = 1076 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPFLSRDGI+LEVCGL+CD Sbjct: 1047 ASIFSLLWVRINPFLSRDGIILEVCGLNCD 1076 >ref|XP_012080728.1| cellulose synthase A catalytic subunit 2 [UDP-forming] [Jatropha curcas] gb|KDP30751.1| hypothetical protein JCGZ_15180 [Jatropha curcas] Length = 1092 Score = 62.4 bits (150), Expect = 5e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPFLS+DGIVLE+CGL+CD Sbjct: 1063 ASIFSLLWVRVNPFLSKDGIVLEICGLNCD 1092 >ref|XP_019153045.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Ipomoea nil] Length = 1083 Score = 62.0 bits (149), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDG+VLEVCGLDC+ Sbjct: 1054 ASIFSLLWVRINPFVSRDGLVLEVCGLDCE 1083 >ref|XP_019174455.1| PREDICTED: cellulose synthase A catalytic subunit 2 [UDP-forming]-like [Ipomoea nil] Length = 1092 Score = 62.0 bits (149), Expect = 6e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVR+NPF+SRDG+VLEVCGLDC+ Sbjct: 1063 ASIFSLLWVRINPFVSRDGLVLEVCGLDCE 1092 >gb|EPS73674.1| cellulose synthase catalytic subunit, partial [Genlisea aurea] Length = 522 Score = 61.6 bits (148), Expect = 7e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPFLSRDG+VLEVCGL+C+ Sbjct: 493 ASIFSLLWVRVNPFLSRDGLVLEVCGLNCE 522 >gb|KVH99583.1| Cellulose synthase [Cynara cardunculus var. scolymus] Length = 966 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPFL R GIVLEVCGLDCD Sbjct: 937 ASIFSLLWVRVNPFLDRGGIVLEVCGLDCD 966 >ref|XP_022039721.1| cellulose synthase A catalytic subunit 5 [UDP-forming]-like [Helianthus annuus] gb|OTG26738.1| putative cellulose synthase [Helianthus annuus] Length = 1084 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPFL R GIVLEVCGLDCD Sbjct: 1055 ASIFSLLWVRVNPFLDRGGIVLEVCGLDCD 1084 >ref|XP_022039720.1| cellulose synthase A catalytic subunit 5 [UDP-forming]-like [Helianthus annuus] gb|OTG26740.1| putative cellulose synthase [Helianthus annuus] Length = 1087 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 528 ASIFSLLWVRVNPFLSRDGIVLEVCGLDCD 439 ASIFSLLWVRVNPFL R GIVLEVCGLDCD Sbjct: 1058 ASIFSLLWVRVNPFLDRGGIVLEVCGLDCD 1087