BLASTX nr result
ID: Acanthopanax24_contig00013112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00013112 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21473.3| unnamed protein product, partial [Vitis vinifera] 80 2e-14 ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation ... 80 3e-14 ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation ... 80 3e-14 gb|PIN03015.1| Acinus (induces apoptotic chromatin condensation)... 79 5e-14 ref|XP_019191232.1| PREDICTED: formin-like protein 5 [Ipomoea nil] 79 5e-14 ref|XP_022739741.1| apoptotic chromatin condensation inducer in ... 79 5e-14 ref|XP_011097605.1| histone acetyltransferase KAT6A [Sesamum ind... 79 5e-14 gb|PIN14485.1| Acinus (induces apoptotic chromatin condensation)... 79 7e-14 ref|XP_022774926.1| apoptotic chromatin condensation inducer in ... 79 7e-14 gb|OTF98472.1| putative SAP domain-containing protein [Helianthu... 79 9e-14 ref|XP_022005156.1| apoptotic chromatin condensation inducer in ... 79 9e-14 gb|OMO56002.1| hypothetical protein CCACVL1_26833 [Corchorus cap... 79 1e-13 dbj|GAU30455.1| hypothetical protein TSUD_392680 [Trifolium subt... 78 1e-13 emb|CDP20799.1| unnamed protein product [Coffea canephora] 78 1e-13 ref|XP_023912044.1| apoptotic chromatin condensation inducer in ... 78 1e-13 gb|POF10916.1| isoform 2 of apoptotic chromatin condensation ind... 78 1e-13 ref|XP_003602011.1| SAP domain protein [Medicago truncatula] >gi... 78 2e-13 gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partia... 76 2e-13 ref|XP_016508163.1| PREDICTED: uncharacterized protein LOC107825... 77 2e-13 gb|EOX92212.1| SAP domain-containing protein isoform 2 [Theobrom... 77 2e-13 >emb|CBI21473.3| unnamed protein product, partial [Vitis vinifera] Length = 413 Score = 80.1 bits (196), Expect = 2e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLF+KTKATPRIYYLPLS+EQVAAK AQG TKQ Sbjct: 369 KVDPPIVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKAQGKNTKQ 413 >ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X2 [Vitis vinifera] Length = 662 Score = 80.1 bits (196), Expect = 3e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLF+KTKATPRIYYLPLS+EQVAAK AQG TKQ Sbjct: 618 KVDPPIVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKAQGKNTKQ 662 >ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X1 [Vitis vinifera] Length = 691 Score = 80.1 bits (196), Expect = 3e-14 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLF+KTKATPRIYYLPLS+EQVAAK AQG TKQ Sbjct: 618 KVDPPIVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKAQGKNTKQ 662 >gb|PIN03015.1| Acinus (induces apoptotic chromatin condensation) [Handroanthus impetiginosus] Length = 760 Score = 79.3 bits (194), Expect = 5e-14 Identities = 39/45 (86%), Positives = 39/45 (86%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAK AQG Q Sbjct: 716 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKLKAQGKNVNQ 760 >ref|XP_019191232.1| PREDICTED: formin-like protein 5 [Ipomoea nil] Length = 767 Score = 79.3 bits (194), Expect = 5e-14 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLFRKT+ATPR+YYLPLSDEQV AK AQG TKQ Sbjct: 595 KVDPPIVTLDDLFRKTRATPRVYYLPLSDEQVEAKLKAQGKDTKQ 639 >ref|XP_022739741.1| apoptotic chromatin condensation inducer in the nucleus [Durio zibethinus] Length = 774 Score = 79.3 bits (194), Expect = 5e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKT+ATPRIYYLPLS+EQVAAKQ A+G TKQ Sbjct: 696 KLDPPIVTLDDLFRKTRATPRIYYLPLSEEQVAAKQVARGRNTKQ 740 >ref|XP_011097605.1| histone acetyltransferase KAT6A [Sesamum indicum] Length = 898 Score = 79.3 bits (194), Expect = 5e-14 Identities = 39/45 (86%), Positives = 39/45 (86%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAK AQG Q Sbjct: 749 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKLKAQGKNVNQ 793 >gb|PIN14485.1| Acinus (induces apoptotic chromatin condensation) [Handroanthus impetiginosus] Length = 760 Score = 79.0 bits (193), Expect = 7e-14 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAK AQG Q Sbjct: 716 KIDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKLKAQGKNVNQ 760 >ref|XP_022774926.1| apoptotic chromatin condensation inducer in the nucleus-like [Durio zibethinus] ref|XP_022774927.1| apoptotic chromatin condensation inducer in the nucleus-like [Durio zibethinus] Length = 821 Score = 79.0 bits (193), Expect = 7e-14 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPLS+EQVAAK+ A G TKQ Sbjct: 684 KLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKRAAHGRNTKQ 728 >gb|OTF98472.1| putative SAP domain-containing protein [Helianthus annuus] Length = 609 Score = 78.6 bits (192), Expect = 9e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQG 127 KVDPPIVTLDDLF+KT+ATPRIYYLPLSDEQVAAK NAQG Sbjct: 565 KVDPPIVTLDDLFKKTRATPRIYYLPLSDEQVAAKLNAQG 604 >ref|XP_022005156.1| apoptotic chromatin condensation inducer in the nucleus-like [Helianthus annuus] Length = 648 Score = 78.6 bits (192), Expect = 9e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQG 127 KVDPPIVTLDDLF+KT+ATPRIYYLPLSDEQVAAK NAQG Sbjct: 604 KVDPPIVTLDDLFKKTRATPRIYYLPLSDEQVAAKLNAQG 643 >gb|OMO56002.1| hypothetical protein CCACVL1_26833 [Corchorus capsularis] Length = 1383 Score = 78.6 bits (192), Expect = 1e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPLS+EQVAAK+ A+G TKQ Sbjct: 573 KLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKRAARGRYTKQ 617 >dbj|GAU30455.1| hypothetical protein TSUD_392680 [Trifolium subterraneum] Length = 712 Score = 78.2 bits (191), Expect = 1e-13 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K DPPIVTLDDLFRKTKATPRIYYLPLS+EQVAAK AQG T+Q Sbjct: 668 KADPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLAAQGKNTRQ 712 >emb|CDP20799.1| unnamed protein product [Coffea canephora] Length = 725 Score = 78.2 bits (191), Expect = 1e-13 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPI+TLDDLFRKTKATPRIYYLPLSD QVAAK AQG T KQ Sbjct: 681 KIDPPILTLDDLFRKTKATPRIYYLPLSDGQVAAKLQAQGKTGKQ 725 >ref|XP_023912044.1| apoptotic chromatin condensation inducer in the nucleus [Quercus suber] Length = 736 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPL++EQVAAK AQG T+Q Sbjct: 692 KLDPPIVTLDDLFRKTKATPRIYYLPLTEEQVAAKLTAQGKNTRQ 736 >gb|POF10916.1| isoform 2 of apoptotic chromatin condensation inducer in the nucleus [Quercus suber] Length = 826 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPL++EQVAAK AQG T+Q Sbjct: 706 KLDPPIVTLDDLFRKTKATPRIYYLPLTEEQVAAKLTAQGKNTRQ 750 >ref|XP_003602011.1| SAP domain protein [Medicago truncatula] gb|AES72262.1| SAP domain protein [Medicago truncatula] Length = 720 Score = 77.8 bits (190), Expect = 2e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 KVDPPIVTLDDLFRKT ATPRIYYLPLS+EQVAAK AQG +T+Q Sbjct: 676 KVDPPIVTLDDLFRKTTATPRIYYLPLSEEQVAAKLAAQGKSTRQ 720 >gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partial [Erythranthe guttata] Length = 278 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQG 127 KVDPPIVTLDDLFRKTKA PRIYYLPLSDEQVAAK AQG Sbjct: 235 KVDPPIVTLDDLFRKTKAIPRIYYLPLSDEQVAAKLKAQG 274 >ref|XP_016508163.1| PREDICTED: uncharacterized protein LOC107825767 isoform X2 [Nicotiana tabacum] Length = 738 Score = 77.4 bits (189), Expect = 2e-13 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPLSDEQVA K AQG KQ Sbjct: 694 KLDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAEKLKAQGKIIKQ 738 >gb|EOX92212.1| SAP domain-containing protein isoform 2 [Theobroma cacao] Length = 740 Score = 77.4 bits (189), Expect = 2e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 246 KVDPPIVTLDDLFRKTKATPRIYYLPLSDEQVAAKQNAQGITTKQ 112 K+DPPIVTLDDLFRKTKATPRIYYLPLS+EQVAAK+ A+G KQ Sbjct: 696 KLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKRAARGRNVKQ 740