BLASTX nr result
ID: Acanthopanax24_contig00013001
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00013001 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017252403.1| PREDICTED: pentatricopeptide repeat-containi... 54 8e-06 ref|XP_017252401.1| PREDICTED: pentatricopeptide repeat-containi... 54 8e-06 gb|KZM93266.1| hypothetical protein DCAR_016511 [Daucus carota s... 54 8e-06 >ref|XP_017252403.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X2 [Daucus carota subsp. sativus] Length = 734 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -1 Query: 394 PSEGAETEDIITLSNSPFPPERRTLPSNVQRGQHGGVDTETNNRMRTELVTSAV 233 P + EDII LSNSPFPPE+R N R Q+G V+ T R + EL+TS V Sbjct: 681 PLGAIKGEDIIPLSNSPFPPEKRATIDNSNRSQNGNVEKGTKRRSKPELMTSGV 734 >ref|XP_017252401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74850, chloroplastic isoform X1 [Daucus carota subsp. sativus] Length = 864 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -1 Query: 394 PSEGAETEDIITLSNSPFPPERRTLPSNVQRGQHGGVDTETNNRMRTELVTSAV 233 P + EDII LSNSPFPPE+R N R Q+G V+ T R + EL+TS V Sbjct: 811 PLGAIKGEDIIPLSNSPFPPEKRATIDNSNRSQNGNVEKGTKRRSKPELMTSGV 864 >gb|KZM93266.1| hypothetical protein DCAR_016511 [Daucus carota subsp. sativus] Length = 873 Score = 54.3 bits (129), Expect = 8e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -1 Query: 394 PSEGAETEDIITLSNSPFPPERRTLPSNVQRGQHGGVDTETNNRMRTELVTSAV 233 P + EDII LSNSPFPPE+R N R Q+G V+ T R + EL+TS V Sbjct: 820 PLGAIKGEDIIPLSNSPFPPEKRATIDNSNRSQNGNVEKGTKRRSKPELMTSGV 873