BLASTX nr result
ID: Acanthopanax24_contig00012808
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00012808 (627 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016550434.1| PREDICTED: cyclin-dependent kinase F-4-like ... 60 7e-07 ref|XP_009619969.1| PREDICTED: cyclin-dependent kinase F-4 [Nico... 60 7e-07 emb|CDP14933.1| unnamed protein product [Coffea canephora] 60 7e-07 ref|XP_019254494.1| PREDICTED: cyclin-dependent kinase F-4-like ... 60 7e-07 ref|XP_016503608.1| PREDICTED: cyclin-dependent kinase F-4-like ... 60 7e-07 ref|XP_009794518.1| PREDICTED: cyclin-dependent kinase F-4-like ... 60 7e-07 ref|XP_017218748.1| PREDICTED: cyclin-dependent kinase F-4-like ... 59 1e-06 ref|XP_020978439.1| cyclin-dependent kinase F-4 isoform X2 [Arac... 56 1e-06 gb|PHU08650.1| Serine/threonine-protein kinase MAK [Capsicum chi... 59 2e-06 gb|PHT95833.1| Serine/threonine-protein kinase MAK [Capsicum ann... 59 2e-06 gb|PHT58314.1| Serine/threonine-protein kinase MAK [Capsicum bac... 59 2e-06 ref|XP_018629890.1| PREDICTED: cyclin-dependent kinase F-4-like ... 58 2e-06 ref|XP_016444292.1| PREDICTED: cyclin-dependent kinase F-4-like ... 58 2e-06 gb|EPS73064.1| hypothetical protein M569_01692, partial [Genlise... 58 2e-06 ref|XP_015170674.1| PREDICTED: cyclin-dependent kinase F-4 isofo... 58 3e-06 ref|XP_017223532.1| PREDICTED: cyclin-dependent kinase F-4-like ... 58 3e-06 ref|XP_015170673.1| PREDICTED: cyclin-dependent kinase F-4 isofo... 58 3e-06 ref|XP_015085315.1| PREDICTED: cyclin-dependent kinase F-4 isofo... 58 3e-06 ref|XP_010324488.1| PREDICTED: cyclin-dependent kinase F-4 isofo... 58 3e-06 ref|XP_015170672.1| PREDICTED: cyclin-dependent kinase F-4 isofo... 58 3e-06 >ref|XP_016550434.1| PREDICTED: cyclin-dependent kinase F-4-like [Capsicum annuum] Length = 447 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_009619969.1| PREDICTED: cyclin-dependent kinase F-4 [Nicotiana tomentosiformis] ref|XP_016477732.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana tabacum] Length = 449 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >emb|CDP14933.1| unnamed protein product [Coffea canephora] Length = 450 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_019254494.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana attenuata] gb|OIS97807.1| cyclin-dependent kinase f-4 [Nicotiana attenuata] Length = 461 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_016503608.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana tabacum] Length = 461 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_009794518.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana sylvestris] Length = 461 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_017218748.1| PREDICTED: cyclin-dependent kinase F-4-like [Daucus carota subsp. sativus] ref|XP_017218749.1| PREDICTED: cyclin-dependent kinase F-4-like [Daucus carota subsp. sativus] gb|KZM87849.1| hypothetical protein DCAR_024950 [Daucus carota subsp. sativus] Length = 450 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQTG Sbjct: 1 MERYKLIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_020978439.1| cyclin-dependent kinase F-4 isoform X2 [Arachis ipaensis] Length = 143 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVG+GTFGSVWRA+NKQTG Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQTG 27 >gb|PHU08650.1| Serine/threonine-protein kinase MAK [Capsicum chinense] Length = 447 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 M+RYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MDRYKIIKEVGNGTFGSVWRALNKQTG 27 >gb|PHT95833.1| Serine/threonine-protein kinase MAK [Capsicum annuum] Length = 447 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 M+RYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MDRYKIIKEVGNGTFGSVWRALNKQTG 27 >gb|PHT58314.1| Serine/threonine-protein kinase MAK [Capsicum baccatum] Length = 452 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 M+RYKIIKEVGNGTFGSVWRALNKQTG Sbjct: 1 MDRYKIIKEVGNGTFGSVWRALNKQTG 27 >ref|XP_018629890.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana tomentosiformis] Length = 328 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVW+ALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWQALNKQTG 27 >ref|XP_016444292.1| PREDICTED: cyclin-dependent kinase F-4-like [Nicotiana tabacum] Length = 382 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVW+ALNKQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWQALNKQTG 27 >gb|EPS73064.1| hypothetical protein M569_01692, partial [Genlisea aurea] Length = 384 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +1 Query: 481 FLICP-HYFFAK*GSYEQLTSASMERYKIIKEVGNGTFGSVWRALNKQTG 627 F+ C H + +L +A MERYK+IKEVGNGTFGSVWRA+++Q+G Sbjct: 2 FITCSLHLVINSISTLRELLAARMERYKVIKEVGNGTFGSVWRAISQQSG 51 >ref|XP_015170674.1| PREDICTED: cyclin-dependent kinase F-4 isoform X4 [Solanum tuberosum] Length = 445 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQ+G Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSG 27 >ref|XP_017223532.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Daucus carota subsp. sativus] Length = 446 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYKIIKEVGNGTFGSVWRAL+KQTG Sbjct: 1 MERYKIIKEVGNGTFGSVWRALHKQTG 27 >ref|XP_015170673.1| PREDICTED: cyclin-dependent kinase F-4 isoform X3 [Solanum tuberosum] Length = 446 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQ+G Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSG 27 >ref|XP_015085315.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Solanum pennellii] Length = 450 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQ+G Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSG 27 >ref|XP_010324488.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Solanum lycopersicum] Length = 450 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQ+G Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSG 27 >ref|XP_015170672.1| PREDICTED: cyclin-dependent kinase F-4 isoform X2 [Solanum tuberosum] Length = 450 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 547 MERYKIIKEVGNGTFGSVWRALNKQTG 627 MERYK+IKEVGNGTFGSVWRALNKQ+G Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSG 27