BLASTX nr result
ID: Acanthopanax24_contig00012719
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00012719 (752 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017219608.1| PREDICTED: MACPF domain-containing protein A... 65 3e-08 ref|XP_016474395.1| PREDICTED: MACPF domain-containing protein A... 64 3e-08 gb|KZM86668.1| hypothetical protein DCAR_023802 [Daucus carota s... 65 4e-08 ref|XP_021897068.1| LOW QUALITY PROTEIN: MACPF domain-containing... 64 4e-08 ref|XP_009762677.1| PREDICTED: MACPF domain-containing protein A... 64 4e-08 gb|EOY05048.1| MAC/Perforin domain-containing protein isoform 2 ... 64 7e-08 ref|XP_016501029.1| PREDICTED: MACPF domain-containing protein A... 62 8e-08 ref|XP_017975439.1| PREDICTED: MACPF domain-containing protein A... 64 8e-08 gb|EOY05047.1| MAC/Perforin domain-containing protein isoform 1 ... 64 8e-08 gb|PHU21155.1| hypothetical protein BC332_06262 [Capsicum chinense] 63 1e-07 ref|XP_016566314.1| PREDICTED: MACPF domain-containing protein A... 63 1e-07 ref|XP_011084156.1| MACPF domain-containing protein At4g24290 [S... 63 1e-07 gb|PON95550.1| Membrane attack complex component/perforin (MACPF... 63 1e-07 ref|XP_015887105.1| PREDICTED: MACPF domain-containing protein A... 63 1e-07 gb|PON66922.1| Membrane attack complex component/perforin (MACPF... 63 1e-07 gb|PIN24327.1| hypothetical protein CDL12_02942 [Handroanthus im... 62 2e-07 gb|OAY51176.1| hypothetical protein MANES_05G194100 [Manihot esc... 62 2e-07 gb|OAY51175.1| hypothetical protein MANES_05G194100 [Manihot esc... 62 2e-07 ref|XP_022735109.1| MACPF domain-containing protein At4g24290-li... 62 2e-07 ref|XP_022735108.1| MACPF domain-containing protein At1g14780-li... 62 3e-07 >ref|XP_017219608.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Daucus carota subsp. sativus] Length = 619 Score = 64.7 bits (156), Expect = 3e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGKK 642 DDY SN+QFLEPVRWK+ SN+CSS+V+HD NW++G++ Sbjct: 437 DDYESNEQFLEPVRWKKFSNVCSSVVRHDPNWLQGQE 473 >ref|XP_016474395.1| PREDICTED: MACPF domain-containing protein At1g14780-like [Nicotiana tabacum] Length = 391 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S+DQFLEPVRW R SN+CSS+VKHDL+W++G+ Sbjct: 208 DDYESSDQFLEPVRWPRYSNVCSSVVKHDLSWMQGE 243 >gb|KZM86668.1| hypothetical protein DCAR_023802 [Daucus carota subsp. sativus] Length = 902 Score = 64.7 bits (156), Expect = 4e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGKK 642 DDY SN+QFLEPVRWK+ SN+CSS+V+HD NW++G++ Sbjct: 720 DDYESNEQFLEPVRWKKFSNVCSSVVRHDPNWLQGQE 756 >ref|XP_021897068.1| LOW QUALITY PROTEIN: MACPF domain-containing protein At1g14780-like [Carica papaya] Length = 568 Score = 64.3 bits (155), Expect = 4e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY ++DQFLEPVRWKR SN+C+S+VKHD NW++G Sbjct: 389 DDYRTSDQFLEPVRWKRYSNICTSVVKHDTNWLQG 423 >ref|XP_009762677.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Nicotiana sylvestris] Length = 615 Score = 64.3 bits (155), Expect = 4e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S+DQFLEPVRW R SN+CSS+VKHDL+W++G+ Sbjct: 432 DDYESSDQFLEPVRWPRYSNVCSSVVKHDLSWMQGE 467 >gb|EOY05048.1| MAC/Perforin domain-containing protein isoform 2 [Theobroma cacao] Length = 490 Score = 63.5 bits (153), Expect = 7e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIK 651 DDY S+DQFLEPVRWKR SN+C+S+VKHD NW+K Sbjct: 311 DDYNSSDQFLEPVRWKRYSNVCTSVVKHDPNWLK 344 >ref|XP_016501029.1| PREDICTED: MACPF domain-containing protein At1g14780-like [Nicotiana tabacum] Length = 203 Score = 61.6 bits (148), Expect = 8e-08 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S+DQFLEPVRW R SN+CSS+VKHD +W++G+ Sbjct: 20 DDYESSDQFLEPVRWPRYSNVCSSVVKHDPSWMQGE 55 >ref|XP_017975439.1| PREDICTED: MACPF domain-containing protein At1g14780 [Theobroma cacao] Length = 603 Score = 63.5 bits (153), Expect = 8e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIK 651 DDY S+DQFLEPVRWKR SN+C+S+VKHD NW+K Sbjct: 424 DDYNSSDQFLEPVRWKRYSNVCTSVVKHDPNWLK 457 >gb|EOY05047.1| MAC/Perforin domain-containing protein isoform 1 [Theobroma cacao] Length = 603 Score = 63.5 bits (153), Expect = 8e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIK 651 DDY S+DQFLEPVRWKR SN+C+S+VKHD NW+K Sbjct: 424 DDYNSSDQFLEPVRWKRYSNVCTSVVKHDPNWLK 457 >gb|PHU21155.1| hypothetical protein BC332_06262 [Capsicum chinense] Length = 616 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S+DQFLEP+RWKR SN+CSS+VKHD W++G+ Sbjct: 433 DDYESSDQFLEPIRWKRYSNVCSSVVKHDPRWMQGE 468 >ref|XP_016566314.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Capsicum annuum] ref|XP_016566315.1| PREDICTED: MACPF domain-containing protein At4g24290-like [Capsicum annuum] gb|PHT39471.1| hypothetical protein CQW23_23044 [Capsicum baccatum] gb|PHT63804.1| hypothetical protein T459_32333 [Capsicum annuum] Length = 616 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S+DQFLEP+RWKR SN+CSS+VKHD W++G+ Sbjct: 433 DDYESSDQFLEPIRWKRYSNVCSSVVKHDPRWMQGE 468 >ref|XP_011084156.1| MACPF domain-containing protein At4g24290 [Sesamum indicum] Length = 619 Score = 63.2 bits (152), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S DQFLEPVRWKR SN+CSS+VKHD +W++G+ Sbjct: 437 DDYESCDQFLEPVRWKRYSNVCSSVVKHDPSWVQGE 472 >gb|PON95550.1| Membrane attack complex component/perforin (MACPF) domain containing protein [Trema orientalis] Length = 626 Score = 63.2 bits (152), Expect = 1e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY +DQFLEPVRWK+ SN+C+S+VKHD NW+KG Sbjct: 447 DDYEFSDQFLEPVRWKKYSNICTSVVKHDPNWLKG 481 >ref|XP_015887105.1| PREDICTED: MACPF domain-containing protein At1g14780-like [Ziziphus jujuba] Length = 624 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY SN QFLEP++WKR SN+C+ +VKHD NW+KG Sbjct: 445 DDYESNHQFLEPIKWKRYSNICTQVVKHDPNWLKG 479 >gb|PON66922.1| Membrane attack complex component/perforin (MACPF) domain containing protein [Parasponia andersonii] Length = 626 Score = 62.8 bits (151), Expect = 1e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY +DQFLEP+RWK+ SN+C+S+VKHD NW+KG Sbjct: 447 DDYEFSDQFLEPIRWKKYSNICTSVVKHDPNWLKG 481 >gb|PIN24327.1| hypothetical protein CDL12_02942 [Handroanthus impetiginosus] Length = 616 Score = 62.4 bits (150), Expect = 2e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKGK 645 DDY S++QFLEPVRWKR SN+CSS+V HD NW++G+ Sbjct: 434 DDYESSNQFLEPVRWKRYSNVCSSVVNHDPNWLQGE 469 >gb|OAY51176.1| hypothetical protein MANES_05G194100 [Manihot esculenta] Length = 433 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY S+DQFLEP+RWKR S +C+S+VKHD NW++G Sbjct: 254 DDYKSSDQFLEPIRWKRYSKVCTSVVKHDPNWLQG 288 >gb|OAY51175.1| hypothetical protein MANES_05G194100 [Manihot esculenta] Length = 455 Score = 62.0 bits (149), Expect = 2e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIKG 648 DDY S+DQFLEP+RWKR S +C+S+VKHD NW++G Sbjct: 276 DDYKSSDQFLEPIRWKRYSKVCTSVVKHDPNWLQG 310 >ref|XP_022735109.1| MACPF domain-containing protein At4g24290-like isoform X2 [Durio zibethinus] Length = 527 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIK 651 DDY S+DQFLEPVRWKR SN+C+S+VKHD NW++ Sbjct: 348 DDYNSSDQFLEPVRWKRYSNVCTSVVKHDPNWLQ 381 >ref|XP_022735108.1| MACPF domain-containing protein At1g14780-like isoform X1 [Durio zibethinus] Length = 603 Score = 62.0 bits (149), Expect = 3e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 752 DDYVSNDQFLEPVRWKRDSNLCSSIVKHDLNWIK 651 DDY S+DQFLEPVRWKR SN+C+S+VKHD NW++ Sbjct: 424 DDYNSSDQFLEPVRWKRYSNVCTSVVKHDPNWLQ 457