BLASTX nr result
ID: Acanthopanax24_contig00010208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00010208 (759 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW66302.1| hypothetical protein EUGRSUZ_F00127 [Eucalyptus g... 60 9e-08 >gb|KCW66302.1| hypothetical protein EUGRSUZ_F00127 [Eucalyptus grandis] Length = 152 Score = 60.5 bits (145), Expect = 9e-08 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +2 Query: 242 HAFEYHRSWCRWRVWSWARPWMGIWHRIWQSVPVF*AHIP 361 HA + WCRWR+WS RPWMGIWH +W+SV V +IP Sbjct: 56 HAVKLPGPWCRWRLWSRIRPWMGIWHCLWKSVSVIHINIP 95