BLASTX nr result
ID: Acanthopanax24_contig00009860
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00009860 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM94403.1| hypothetical protein DCAR_017646 [Daucus carota s... 59 5e-07 ref|XP_017252109.1| PREDICTED: protein MOS2-like [Daucus carota ... 59 5e-07 ref|XP_017219833.1| PREDICTED: protein MOS2-like [Daucus carota ... 57 1e-06 >gb|KZM94403.1| hypothetical protein DCAR_017646 [Daucus carota subsp. sativus] Length = 466 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 467 AVVQDADS*KPLHVLLEQIAEYTGDPSDIGY 375 AVV+DAD+ KPLHVLLEQIAEYTGDPS+IGY Sbjct: 436 AVVEDADTRKPLHVLLEQIAEYTGDPSEIGY 466 >ref|XP_017252109.1| PREDICTED: protein MOS2-like [Daucus carota subsp. sativus] ref|XP_017252110.1| PREDICTED: protein MOS2-like [Daucus carota subsp. sativus] Length = 481 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 467 AVVQDADS*KPLHVLLEQIAEYTGDPSDIGY 375 AVV+DAD+ KPLHVLLEQIAEYTGDPS+IGY Sbjct: 451 AVVEDADTRKPLHVLLEQIAEYTGDPSEIGY 481 >ref|XP_017219833.1| PREDICTED: protein MOS2-like [Daucus carota subsp. sativus] ref|XP_017219834.1| PREDICTED: protein MOS2-like [Daucus carota subsp. sativus] gb|KZM86284.1| hypothetical protein DCAR_023418 [Daucus carota subsp. sativus] Length = 466 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 467 AVVQDADS*KPLHVLLEQIAEYTGDPSDIGY 375 A+V+DAD+ KPLHVLLEQIAEYTGDPS+IGY Sbjct: 436 ALVEDADTRKPLHVLLEQIAEYTGDPSEIGY 466