BLASTX nr result
ID: Acanthopanax24_contig00009442
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00009442 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN03372.1| hypothetical protein DCAR_012128 [Daucus carota s... 57 2e-07 ref|XP_022842086.1| uncharacterized protein LOC111365800 [Olea e... 54 4e-06 >gb|KZN03372.1| hypothetical protein DCAR_012128 [Daucus carota subsp. sativus] Length = 81 Score = 56.6 bits (135), Expect = 2e-07 Identities = 31/64 (48%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +3 Query: 3 VQYKNGGLL---LTESPSASYMRLPGDSGRFQILQXXXXXXXXXXXXXXXXXXXXTGVQS 173 VQY+NGG + L+ESPSA+YMRLPGDSGRFQ LQ GVQ+ Sbjct: 13 VQYRNGGDMGSFLSESPSAAYMRLPGDSGRFQALQANHRGKSPCSSPSKAAKQPAVGVQT 72 Query: 174 PGVH 185 G+H Sbjct: 73 RGIH 76 >ref|XP_022842086.1| uncharacterized protein LOC111365800 [Olea europaea var. sylvestris] Length = 85 Score = 53.5 bits (127), Expect = 4e-06 Identities = 34/72 (47%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Frame = +3 Query: 3 VQYKNGG-----LLLTESPSASYMRLPGDSGRFQILQXXXXXXXXXXXXXXXXXXXXTGV 167 +QYKNGG L ESPSASY+RLPGDSGRFQ TGV Sbjct: 13 MQYKNGGQGEKGAWLNESPSASYVRLPGDSGRFQ-TSDIQLLSTSSPPSSATNMVVATGV 71 Query: 168 QSPGVHSTSHRA 203 +SPG H T RA Sbjct: 72 KSPGSHLTFRRA 83