BLASTX nr result
ID: Acanthopanax24_contig00008744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00008744 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024037544.1| protein FEZ isoform X2 [Citrus clementina] 56 2e-06 gb|KDO72531.1| hypothetical protein CISIN_1g015827mg [Citrus sin... 56 2e-06 ref|XP_006482563.1| PREDICTED: protein FEZ [Citrus sinensis] 56 2e-06 dbj|GAY61881.1| hypothetical protein CUMW_213440 [Citrus unshiu] 56 2e-06 gb|KDO72532.1| hypothetical protein CISIN_1g015827mg [Citrus sin... 56 2e-06 ref|XP_006431114.1| protein FEZ isoform X1 [Citrus clementina] >... 56 2e-06 ref|XP_021640150.1| protein FEZ-like [Hevea brasiliensis] 55 4e-06 ref|XP_022741875.1| uncharacterized protein LOC111293394 [Durio ... 55 5e-06 ref|XP_021297726.1| protein FEZ [Herrania umbratica] 54 8e-06 >ref|XP_024037544.1| protein FEZ isoform X2 [Citrus clementina] Length = 398 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >gb|KDO72531.1| hypothetical protein CISIN_1g015827mg [Citrus sinensis] Length = 398 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >ref|XP_006482563.1| PREDICTED: protein FEZ [Citrus sinensis] Length = 398 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >dbj|GAY61881.1| hypothetical protein CUMW_213440 [Citrus unshiu] Length = 399 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >gb|KDO72532.1| hypothetical protein CISIN_1g015827mg [Citrus sinensis] Length = 399 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >ref|XP_006431114.1| protein FEZ isoform X1 [Citrus clementina] gb|ESR44354.1| hypothetical protein CICLE_v10011891mg [Citrus clementina] Length = 399 Score = 56.2 bits (134), Expect = 2e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDD+NE+DKIDDVMLPGFRFHPTDE Sbjct: 1 MDDKNEIDKIDDVMLPGFRFHPTDE 25 >ref|XP_021640150.1| protein FEZ-like [Hevea brasiliensis] Length = 419 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -2 Query: 77 MDDRNEVDKIDDVMLPGFRFHPTDE 3 MDDRN+VDKID+VMLPGFRFHPTDE Sbjct: 1 MDDRNDVDKIDEVMLPGFRFHPTDE 25 >ref|XP_022741875.1| uncharacterized protein LOC111293394 [Durio zibethinus] Length = 675 Score = 55.1 bits (131), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 95 KRSARNMDDRNEVDKIDDVMLPGFRFHPTDE 3 +RS N D++N+VDK++DVMLPGFRFHPTDE Sbjct: 291 ERSKSNKDEKNDVDKVEDVMLPGFRFHPTDE 321 >ref|XP_021297726.1| protein FEZ [Herrania umbratica] Length = 414 Score = 54.3 bits (129), Expect = 8e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -2 Query: 95 KRSARNMDDRNEVDKIDDVMLPGFRFHPTDE 3 +RS NMD++ +VDK++DVMLPGFRFHPTDE Sbjct: 10 RRSKSNMDEKIDVDKVEDVMLPGFRFHPTDE 40