BLASTX nr result
ID: Acanthopanax24_contig00007925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00007925 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHJ81040.1| orf103 (mitochondrion) [Panax ginseng] 66 1e-10 ref|YP_002608359.1| orf104 [Vitis vinifera] >gi|209954156|emb|CA... 66 1e-10 gb|PHT63020.1| hypothetical protein T459_33117 [Capsicum annuum] 62 3e-09 gb|PHU28920.1| hypothetical protein BC332_01013 [Capsicum chinense] 62 3e-09 ref|YP_173422.1| hypothetical protein NitaMp080 [Nicotiana tabac... 62 3e-09 ref|XP_009776241.1| PREDICTED: uncharacterized protein LOC104226... 62 3e-09 ref|YP_009305170.1| hypothetical protein HESP_p25 (mitochondrion... 60 1e-08 gb|PHT79291.1| hypothetical protein T459_17343 [Capsicum annuum] 60 1e-08 gb|PKI40727.1| hypothetical protein CRG98_038865 [Punica granatum] 60 2e-08 gb|KJB09756.1| hypothetical protein B456_001G162300 [Gossypium r... 64 3e-08 gb|PHT50999.1| hypothetical protein CQW23_10746 [Capsicum baccatum] 59 4e-08 gb|ONI16438.1| hypothetical protein PRUPE_3G098000 [Prunus persica] 58 1e-07 ref|YP_005090415.1| orf3 gene product (mitochondrion) [Dorcocera... 58 1e-07 gb|PHT68653.1| hypothetical protein T459_28140 [Capsicum annuum] 57 4e-07 gb|PHU09822.1| hypothetical protein BC332_21682 [Capsicum chinense] 56 5e-07 gb|EXC34909.1| hypothetical protein L484_020025 [Morus notabilis] 55 7e-07 >gb|AHJ81040.1| orf103 (mitochondrion) [Panax ginseng] Length = 103 Score = 65.9 bits (159), Expect = 1e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAPG 231 GR SPQPREWLRPVCPPLFPTCYGAPG Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGAPG 59 >ref|YP_002608359.1| orf104 [Vitis vinifera] emb|CAQ77593.1| orf104 (mitochondrion) [Vitis vinifera] gb|ACS15247.1| ORF104 (mitochondrion) [Vitis vinifera] Length = 103 Score = 65.9 bits (159), Expect = 1e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAPG 231 GR SPQPREWLRPVCPPLFPTCYGAPG Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGAPG 59 >gb|PHT63020.1| hypothetical protein T459_33117 [Capsicum annuum] Length = 102 Score = 62.0 bits (149), Expect = 3e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPREWLRPVCPPLFPTCYG P Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGTP 58 >gb|PHU28920.1| hypothetical protein BC332_01013 [Capsicum chinense] Length = 103 Score = 62.0 bits (149), Expect = 3e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPREWLRPVCPPLFPTCYG P Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGTP 58 >ref|YP_173422.1| hypothetical protein NitaMp080 [Nicotiana tabacum] ref|YP_009049769.1| hypothetical protein (mitochondrion) [Capsicum annuum] dbj|BAD83487.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] gb|AIG89954.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|AIG90127.1| hypothetical protein (mitochondrion) [Capsicum annuum] gb|PHT76098.1| hypothetical protein T459_19620 [Capsicum annuum] gb|PHT95906.1| hypothetical protein T459_03788 [Capsicum annuum] gb|AUS83321.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83368.1| hypothetical protein (mitochondrion) [Solanum tuberosum] gb|AUS83480.1| hypothetical protein (mitochondrion) [Solanum tuberosum] Length = 103 Score = 62.0 bits (149), Expect = 3e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPREWLRPVCPPLFPTCYG P Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGTP 58 >ref|XP_009776241.1| PREDICTED: uncharacterized protein LOC104226058 [Nicotiana sylvestris] Length = 103 Score = 62.0 bits (149), Expect = 3e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPREWLRPVCPPLFPTCYG P Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYGTP 58 >ref|YP_009305170.1| hypothetical protein HESP_p25 (mitochondrion) [Hesperelaea palmeri] gb|AOO96406.1| hypothetical protein HESP_p25 (mitochondrion) [Hesperelaea palmeri] Length = 100 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAPG 231 GR SPQPRE LRPVCPPLFPTCYGAPG Sbjct: 33 GRHSPQPRERLRPVCPPLFPTCYGAPG 59 >gb|PHT79291.1| hypothetical protein T459_17343 [Capsicum annuum] Length = 103 Score = 60.5 bits (145), Expect = 1e-08 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPR+WLRPVCPPLFPTCYG P Sbjct: 33 GRHSPQPRKWLRPVCPPLFPTCYGTP 58 >gb|PKI40727.1| hypothetical protein CRG98_038865 [Punica granatum] Length = 103 Score = 60.1 bits (144), Expect = 2e-08 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAPG 231 GRRSPQPRE RPVCPPLFPTCYGAPG Sbjct: 33 GRRSPQPRECNRPVCPPLFPTCYGAPG 59 >gb|KJB09756.1| hypothetical protein B456_001G162300 [Gossypium raimondii] Length = 1286 Score = 63.5 bits (153), Expect = 3e-08 Identities = 45/118 (38%), Positives = 54/118 (45%), Gaps = 1/118 (0%) Frame = -3 Query: 578 PFSSPDTRQSKSPPPCRSQSSDGTWNHTXXXXXXXXXXXXXXXXXXXACPLRAIRLS*YA 399 PFSSPD RQ+KSPPPCRSQSSDGTWNHT A L + Sbjct: 1012 PFSSPDIRQAKSPPPCRSQSSDGTWNHT-----------------------AAAALRAHL 1048 Query: 398 KQLSDSSSIAIFLXXXXXXXXXXXXXXXRFGSKIFARRPMNLENR-AWGLKTLPHFGP 228 +L + ++A + GSKIFARRPMN + GL+ F P Sbjct: 1049 LRLPVTYALAASIALRSLYSRDGE------GSKIFARRPMNQSRESSMGLEDPTAFRP 1100 >gb|PHT50999.1| hypothetical protein CQW23_10746 [Capsicum baccatum] Length = 103 Score = 59.3 bits (142), Expect = 4e-08 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYG 222 GR SPQPREWLRPVCPPLFPTCYG Sbjct: 33 GRHSPQPREWLRPVCPPLFPTCYG 56 >gb|ONI16438.1| hypothetical protein PRUPE_3G098000 [Prunus persica] Length = 118 Score = 58.2 bits (139), Expect = 1e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 590 KPTTPFSSPDTRQSKSPPPCRSQSSDGTWN 501 KPTTPFS+PDTRQ KS PPCRSQSS+ TWN Sbjct: 17 KPTTPFSAPDTRQLKSSPPCRSQSSNCTWN 46 >ref|YP_005090415.1| orf3 gene product (mitochondrion) [Dorcoceras hygrometricum] gb|AEK53324.1| hypothetical protein (mitochondrion) [Dorcoceras hygrometricum] Length = 103 Score = 57.8 bits (138), Expect = 1e-07 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAPG 231 GR SPQ RE LRPVCPPLFPTCYGAPG Sbjct: 33 GRHSPQQRECLRPVCPPLFPTCYGAPG 59 >gb|PHT68653.1| hypothetical protein T459_28140 [Capsicum annuum] Length = 103 Score = 56.6 bits (135), Expect = 4e-07 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYGAP 228 GR SPQPR+WLRPV PPLFPTCYG P Sbjct: 33 GRHSPQPRDWLRPVYPPLFPTCYGTP 58 >gb|PHU09822.1| hypothetical protein BC332_21682 [Capsicum chinense] Length = 103 Score = 56.2 bits (134), Expect = 5e-07 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +1 Query: 151 GRRSPQPREWLRPVCPPLFPTCYG 222 G SPQPREWLRPVCPPLFPTCYG Sbjct: 33 GWHSPQPREWLRPVCPPLFPTCYG 56 >gb|EXC34909.1| hypothetical protein L484_020025 [Morus notabilis] Length = 62 Score = 54.7 bits (130), Expect = 7e-07 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 238 ISAPGHHSMLGIRGDILDVTTPLVGGCAA 152 + PGH+SM GIRGDILDVTTPLVGGCAA Sbjct: 25 LPTPGHYSMSGIRGDILDVTTPLVGGCAA 53