BLASTX nr result
ID: Acanthopanax24_contig00007637
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00007637 (966 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022751921.1| NAC domain-containing protein 71-like [Durio... 82 3e-23 ref|XP_021673172.1| protein FEZ [Hevea brasiliensis] 81 8e-23 ref|XP_019157128.1| PREDICTED: putative NAC domain-containing pr... 81 8e-23 ref|XP_017607875.1| PREDICTED: protein FEZ [Gossypium arboreum] 80 2e-22 ref|XP_016668254.1| PREDICTED: protein FEZ-like [Gossypium hirsu... 80 2e-22 ref|XP_018805920.1| PREDICTED: protein FEZ-like [Juglans regia] 80 3e-22 ref|XP_016673513.1| PREDICTED: protein FEZ-like [Gossypium hirsu... 79 4e-22 ref|XP_012483628.1| PREDICTED: protein FEZ [Gossypium raimondii]... 79 4e-22 ref|XP_021972117.1| protein FEZ-like [Helianthus annuus] >gi|119... 80 4e-22 ref|XP_021603758.1| protein FEZ-like [Manihot esculenta] >gi|103... 80 5e-22 ref|XP_015879415.1| PREDICTED: protein FEZ [Ziziphus jujuba] 79 5e-22 ref|XP_024037544.1| protein FEZ isoform X2 [Citrus clementina] 80 5e-22 dbj|GAY61881.1| hypothetical protein CUMW_213440 [Citrus unshiu] 79 6e-22 emb|CDP02227.1| unnamed protein product [Coffea canephora] 78 6e-22 gb|KDO72531.1| hypothetical protein CISIN_1g015827mg [Citrus sin... 79 6e-22 ref|XP_006482563.1| PREDICTED: protein FEZ [Citrus sinensis] 79 6e-22 ref|XP_006338456.1| PREDICTED: putative NAC domain-containing pr... 78 6e-22 ref|XP_016498397.1| PREDICTED: putative NAC domain-containing pr... 78 6e-22 ref|XP_009600694.1| PREDICTED: putative NAC domain-containing pr... 78 6e-22 ref|XP_015064899.1| PREDICTED: putative NAC domain-containing pr... 78 6e-22 >ref|XP_022751921.1| NAC domain-containing protein 71-like [Durio zibethinus] Length = 396 Score = 82.4 bits (202), Expect(2) = 3e-23 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLKS+IQQRPLPIELIKQVDIYK++PWDLPNLA Sbjct: 24 DEELVGFYLKSKIQQRPLPIELIKQVDIYKFEPWDLPNLA 63 Score = 55.5 bits (132), Expect(2) = 3e-23 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 ASGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_021673172.1| protein FEZ [Hevea brasiliensis] Length = 398 Score = 81.3 bits (199), Expect(2) = 8e-23 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRPLPIELIKQVDIYKYDPWDLPRLA 63 Score = 55.5 bits (132), Expect(2) = 8e-23 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 TSGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_019157128.1| PREDICTED: putative NAC domain-containing protein 94 [Ipomoea nil] ref|XP_019157129.1| PREDICTED: putative NAC domain-containing protein 94 [Ipomoea nil] Length = 353 Score = 81.3 bits (199), Expect(2) = 8e-23 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQVDIYKYDPWDLP LA Sbjct: 20 DEELVGFYLKRKIQQRPLPIELIKQVDIYKYDPWDLPKLA 59 Score = 55.5 bits (132), Expect(2) = 8e-23 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 60 TSGEKEWYFYCPRDRKYRNSARP 82 >ref|XP_017607875.1| PREDICTED: protein FEZ [Gossypium arboreum] Length = 386 Score = 80.1 bits (196), Expect(2) = 2e-22 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQVDIYKY+PWDLP LA Sbjct: 24 DEELVGFYLKKKIQQRPLPIELIKQVDIYKYEPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 2e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 ASGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_016668254.1| PREDICTED: protein FEZ-like [Gossypium hirsutum] gb|PPS14102.1| hypothetical protein GOBAR_AA06484 [Gossypium barbadense] Length = 386 Score = 80.1 bits (196), Expect(2) = 2e-22 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQVDIYKY+PWDLP LA Sbjct: 24 DEELVGFYLKKKIQQRPLPIELIKQVDIYKYEPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 2e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 ASGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_018805920.1| PREDICTED: protein FEZ-like [Juglans regia] Length = 395 Score = 80.5 bits (197), Expect(2) = 3e-22 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK++IQ+RPLPIELIKQVDIYKYDPWDLP LA Sbjct: 25 DEELVGFYLKTKIQRRPLPIELIKQVDIYKYDPWDLPKLA 64 Score = 54.3 bits (129), Expect(2) = 3e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 65 ATGEKEWYFYCPRDRKYRNSARP 87 >ref|XP_016673513.1| PREDICTED: protein FEZ-like [Gossypium hirsutum] Length = 390 Score = 79.0 bits (193), Expect(2) = 4e-22 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQ+DIYKY+PWDLP LA Sbjct: 28 DEELVGFYLKKKIQQRPLPIELIKQLDIYKYEPWDLPKLA 67 Score = 55.5 bits (132), Expect(2) = 4e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 68 ASGEKEWYFYCPRDRKYRNSARP 90 >ref|XP_012483628.1| PREDICTED: protein FEZ [Gossypium raimondii] gb|AHJ79167.1| NAC domain protein NAC26 [Gossypium hirsutum] gb|KJB33558.1| hypothetical protein B456_006G017700 [Gossypium raimondii] Length = 386 Score = 79.0 bits (193), Expect(2) = 4e-22 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQ+DIYKY+PWDLP LA Sbjct: 24 DEELVGFYLKKKIQQRPLPIELIKQLDIYKYEPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 4e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 ASGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_021972117.1| protein FEZ-like [Helianthus annuus] gb|OTG21003.1| putative NAC domain-containing protein [Helianthus annuus] Length = 352 Score = 80.5 bits (197), Expect(2) = 4e-22 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLPNLA Sbjct: 15 DEELVGFYLKKKIQQRVLPIELIKQVDIYKYDPWDLPNLA 54 Score = 53.9 bits (128), Expect(2) = 4e-22 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 426 SGEKEWYFYCPRDRKYRNSARP 491 +GEKEWYFYCPRDRKYRNSARP Sbjct: 56 TGEKEWYFYCPRDRKYRNSARP 77 >ref|XP_021603758.1| protein FEZ-like [Manihot esculenta] gb|OAY56805.1| hypothetical protein MANES_02G045800 [Manihot esculenta] Length = 401 Score = 79.7 bits (195), Expect(2) = 5e-22 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQ+PLPIELIKQVDIYKYDPWDLP LA Sbjct: 28 DEELVGFYLKRKIQQQPLPIELIKQVDIYKYDPWDLPKLA 67 Score = 54.3 bits (129), Expect(2) = 5e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 68 TTGEKEWYFYCPRDRKYRNSARP 90 >ref|XP_015879415.1| PREDICTED: protein FEZ [Ziziphus jujuba] Length = 401 Score = 78.6 bits (192), Expect(2) = 5e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQ RPLPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQLRPLPIELIKQVDIYKYDPWDLPRLA 63 Score = 55.5 bits (132), Expect(2) = 5e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 S+GEKEWYFYCPRDRKYRNSARP Sbjct: 64 STGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_024037544.1| protein FEZ isoform X2 [Citrus clementina] Length = 398 Score = 79.7 bits (195), Expect(2) = 5e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQRPLPIELIKQVDIYKYDPWDLP A Sbjct: 24 DEELVGFYLKRKIQQRPLPIELIKQVDIYKYDPWDLPKFA 63 Score = 54.3 bits (129), Expect(2) = 5e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 64 TAGEKEWYFYCPRDRKYRNSARP 86 >dbj|GAY61881.1| hypothetical protein CUMW_213440 [Citrus unshiu] Length = 399 Score = 79.3 bits (194), Expect(2) = 6e-22 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLAIFWGER 439 DEELVGFYLK +IQQRPLPIELIKQVDIYKYDPWDLP GE+ Sbjct: 24 DEELVGFYLKRKIQQRPLPIELIKQVDIYKYDPWDLPKELATAGEK 69 Score = 54.3 bits (129), Expect(2) = 6e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 65 TAGEKEWYFYCPRDRKYRNSARP 87 >emb|CDP02227.1| unnamed protein product [Coffea canephora] Length = 399 Score = 78.2 bits (191), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 6e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 +SGEKEWYFYCPRDRKYRNSARP Sbjct: 64 TSGEKEWYFYCPRDRKYRNSARP 86 >gb|KDO72531.1| hypothetical protein CISIN_1g015827mg [Citrus sinensis] Length = 398 Score = 79.3 bits (194), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQ RPLPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQHRPLPIELIKQVDIYKYDPWDLPKLA 63 Score = 54.3 bits (129), Expect(2) = 6e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 64 TAGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_006482563.1| PREDICTED: protein FEZ [Citrus sinensis] Length = 398 Score = 79.3 bits (194), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQ RPLPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQHRPLPIELIKQVDIYKYDPWDLPKLA 63 Score = 54.3 bits (129), Expect(2) = 6e-22 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 ++GEKEWYFYCPRDRKYRNSARP Sbjct: 64 TAGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_006338456.1| PREDICTED: putative NAC domain-containing protein 94 [Solanum tuberosum] Length = 396 Score = 78.2 bits (191), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 6e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 S+GEKEWYFYCPRDRKYRNSARP Sbjct: 64 STGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_016498397.1| PREDICTED: putative NAC domain-containing protein 94 [Nicotiana tabacum] Length = 386 Score = 78.2 bits (191), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPRLA 63 Score = 55.5 bits (132), Expect(2) = 6e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 S+GEKEWYFYCPRDRKYRNSARP Sbjct: 64 STGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_009600694.1| PREDICTED: putative NAC domain-containing protein 94 [Nicotiana tomentosiformis] Length = 386 Score = 78.2 bits (191), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPRLA 63 Score = 55.5 bits (132), Expect(2) = 6e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 S+GEKEWYFYCPRDRKYRNSARP Sbjct: 64 STGEKEWYFYCPRDRKYRNSARP 86 >ref|XP_015064899.1| PREDICTED: putative NAC domain-containing protein 94 [Solanum pennellii] Length = 384 Score = 78.2 bits (191), Expect(2) = 6e-22 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 302 DEELVGFYLKSRIQQRPLPIELIKQVDIYKYDPWDLPNLA 421 DEELVGFYLK +IQQR LPIELIKQVDIYKYDPWDLP LA Sbjct: 24 DEELVGFYLKRKIQQRSLPIELIKQVDIYKYDPWDLPKLA 63 Score = 55.5 bits (132), Expect(2) = 6e-22 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 423 SSGEKEWYFYCPRDRKYRNSARP 491 S+GEKEWYFYCPRDRKYRNSARP Sbjct: 64 STGEKEWYFYCPRDRKYRNSARP 86