BLASTX nr result
ID: Acanthopanax24_contig00007511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00007511 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ24669.1| hypothetical protein RchiOBHm_Chr6g0274971 [Rosa ... 54 6e-06 >gb|PRQ24669.1| hypothetical protein RchiOBHm_Chr6g0274971 [Rosa chinensis] Length = 145 Score = 53.5 bits (127), Expect = 6e-06 Identities = 34/82 (41%), Positives = 45/82 (54%) Frame = -2 Query: 480 TRKKRGSTSAMNTLVSSVPLEAVSMP*KRSTRQ*KTRSMPTSTK*RKESRPGWGLEPGDM 301 TR++R +T+ SV L M RS RQ KTRSMPT T+ ++ S LEP Sbjct: 44 TRRRRSTTNISKNSAGSVLLLLELMLCMRSIRQRKTRSMPTGTRLKRRSLQWLQLEPVGS 103 Query: 300 HSMSIMRRKKPRKKGLMERKNI 235 S S MRRK+ RK+ +RK + Sbjct: 104 PSTSTMRRKRRRKRRRKKRKRL 125