BLASTX nr result
ID: Acanthopanax24_contig00007194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00007194 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU19660.1| Mitochondrial outer membrane protein porin 2 [Cap... 63 5e-09 gb|PHT50403.1| hypothetical protein CQW23_10150 [Capsicum baccatum] 63 5e-09 ref|XP_016570033.1| PREDICTED: mitochondrial outer membrane prot... 63 6e-09 ref|XP_019251353.1| PREDICTED: mitochondrial outer membrane prot... 63 6e-09 ref|XP_016498485.1| PREDICTED: mitochondrial outer membrane prot... 63 6e-09 gb|KVI08917.1| Eukaryotic porin/Tom40 [Cynara cardunculus var. s... 63 6e-09 ref|XP_009801997.1| PREDICTED: mitochondrial outer membrane prot... 63 6e-09 ref|XP_009615970.1| PREDICTED: mitochondrial outer membrane prot... 63 6e-09 ref|XP_019223882.1| PREDICTED: mitochondrial outer membrane prot... 63 8e-09 ref|XP_016508757.1| PREDICTED: mitochondrial outer membrane prot... 63 8e-09 ref|XP_009604076.1| PREDICTED: mitochondrial outer membrane prot... 63 8e-09 gb|PIM99540.1| hypothetical protein CDL12_27965 [Handroanthus im... 60 9e-09 gb|KZM88722.1| hypothetical protein DCAR_025797 [Daucus carota s... 62 1e-08 ref|XP_015067586.1| PREDICTED: mitochondrial outer membrane prot... 62 2e-08 ref|XP_006350613.1| PREDICTED: mitochondrial outer membrane prot... 62 2e-08 ref|XP_004234649.1| PREDICTED: mitochondrial outer membrane prot... 62 2e-08 ref|XP_017219031.1| PREDICTED: mitochondrial outer membrane prot... 62 2e-08 emb|CDP02599.1| unnamed protein product [Coffea canephora] 62 2e-08 ref|XP_023757943.1| mitochondrial outer membrane protein porin 2... 62 2e-08 ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane prot... 62 2e-08 >gb|PHU19660.1| Mitochondrial outer membrane protein porin 2 [Capsicum chinense] Length = 251 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 218 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 250 >gb|PHT50403.1| hypothetical protein CQW23_10150 [Capsicum baccatum] Length = 259 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 226 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 258 >ref|XP_016570033.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Capsicum annuum] gb|PHT83381.1| Mitochondrial outer membrane protein porin 2 [Capsicum annuum] Length = 274 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 241 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 273 >ref|XP_019251353.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana attenuata] gb|OIT08535.1| mitochondrial outer membrane protein porin 2 [Nicotiana attenuata] Length = 276 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_016498485.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana tabacum] Length = 276 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >gb|KVI08917.1| Eukaryotic porin/Tom40 [Cynara cardunculus var. scolymus] Length = 276 Score = 63.2 bits (152), Expect = 6e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HEIIPKSLVT++SE DTKALDKTPRFGLALALK Sbjct: 243 HEIIPKSLVTVSSELDTKALDKTPRFGLALALK 275 >ref|XP_009801997.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana sylvestris] Length = 276 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_009615970.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana tomentosiformis] ref|XP_016475582.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana tabacum] Length = 276 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HEVIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_019223882.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana attenuata] gb|OIT33737.1| mitochondrial outer membrane protein porin 2 [Nicotiana attenuata] Length = 276 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HELIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_016508757.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Nicotiana tabacum] Length = 276 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HELIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_009604076.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Nicotiana tomentosiformis] Length = 276 Score = 62.8 bits (151), Expect = 8e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HELIPKSLLTISSEFDTKALDKTPRFGVALALK 275 >gb|PIM99540.1| hypothetical protein CDL12_27965 [Handroanthus impetiginosus] Length = 107 Score = 59.7 bits (143), Expect = 9e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+I KSLVTI+SEFDTKALDKTPRFG++LALK Sbjct: 74 HEVIRKSLVTISSEFDTKALDKTPRFGVSLALK 106 >gb|KZM88722.1| hypothetical protein DCAR_025797 [Daucus carota subsp. sativus] Length = 243 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+++ASEFDTKALDKTP+FGLALALK Sbjct: 210 HEVIPKSLLSLASEFDTKALDKTPKFGLALALK 242 >ref|XP_015067586.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Solanum pennellii] Length = 274 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTP+FG+ALALK Sbjct: 241 HEVIPKSLLTISSEFDTKALDKTPKFGVALALK 273 >ref|XP_006350613.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Solanum tuberosum] Length = 274 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTP+FG+ALALK Sbjct: 241 HEVIPKSLLTISSEFDTKALDKTPKFGVALALK 273 >ref|XP_004234649.1| PREDICTED: mitochondrial outer membrane protein porin 2 [Solanum lycopersicum] Length = 274 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+TI+SEFDTKALDKTP+FG+ALALK Sbjct: 241 HEVIPKSLLTISSEFDTKALDKTPKFGVALALK 273 >ref|XP_017219031.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Daucus carota subsp. sativus] Length = 276 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKSL+++ASEFDTKALDKTP+FGLALALK Sbjct: 243 HEVIPKSLLSLASEFDTKALDKTPKFGLALALK 275 >emb|CDP02599.1| unnamed protein product [Coffea canephora] Length = 276 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HE+IPKS++TI+SEFDTKALDKTPRFG+ALALK Sbjct: 243 HEVIPKSVLTISSEFDTKALDKTPRFGVALALK 275 >ref|XP_023757943.1| mitochondrial outer membrane protein porin 2-like [Lactuca sativa] gb|PLY89828.1| hypothetical protein LSAT_4X160741 [Lactuca sativa] Length = 276 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HEIIPKSLVT++SE DTKALDKTP+FGLALALK Sbjct: 243 HEIIPKSLVTLSSEMDTKALDKTPKFGLALALK 275 >ref|XP_002279650.2| PREDICTED: mitochondrial outer membrane protein porin 2 [Vitis vinifera] emb|CAN75907.1| hypothetical protein VITISV_001975 [Vitis vinifera] emb|CBI33694.3| unnamed protein product, partial [Vitis vinifera] Length = 276 Score = 61.6 bits (148), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 444 HEIIPKSLVTIASEFDTKALDKTPRFGLALALK 346 HEIIPKS++T++ EFDTKALDKTPRFGLALALK Sbjct: 243 HEIIPKSILTLSGEFDTKALDKTPRFGLALALK 275