BLASTX nr result
ID: Acanthopanax24_contig00007107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00007107 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI38653.1| hypothetical protein CRG98_040939 [Punica granatum] 107 2e-26 gb|POF04718.1| atp-citrate synthase alpha chain protein 3 [Querc... 105 7e-25 ref|XP_008360239.2| PREDICTED: ATP-citrate synthase alpha chain ... 102 2e-24 gb|OWM71041.1| hypothetical protein CDL15_Pgr011168 [Punica gran... 107 4e-24 ref|XP_008351142.1| PREDICTED: ATP-citrate synthase alpha chain ... 103 5e-24 ref|XP_014626982.1| PREDICTED: ATP-citrate synthase alpha chain ... 102 5e-24 gb|KCW64419.1| hypothetical protein EUGRSUZ_G02039 [Eucalyptus g... 105 1e-23 ref|XP_012088841.1| ATP-citrate synthase alpha chain protein 2 [... 105 1e-23 ref|XP_010066514.1| PREDICTED: ATP-citrate synthase alpha chain ... 105 1e-23 emb|CDY31089.1| BnaA08g26390D [Brassica napus] 101 1e-23 gb|KJB45487.1| hypothetical protein B456_007G308700 [Gossypium r... 103 1e-23 gb|AQK48282.1| ATP-citrate synthase alpha chain protein 3 [Zea m... 102 1e-23 gb|KCW64420.1| hypothetical protein EUGRSUZ_G02039 [Eucalyptus g... 105 2e-23 gb|PNT34284.1| hypothetical protein POPTR_005G004900v3 [Populus ... 104 2e-23 ref|XP_023917167.1| ATP-citrate synthase alpha chain protein 2 [... 105 2e-23 gb|KHN43368.1| ATP-citrate synthase alpha chain protein 3 [Glyci... 102 2e-23 dbj|GAY58825.1| hypothetical protein CUMW_189770 [Citrus unshiu] 102 2e-23 gb|PNX65914.1| ATP-citrate synthase alpha chain protein 1-like, ... 97 2e-23 ref|XP_017186531.1| PREDICTED: ATP-citrate synthase alpha chain ... 102 2e-23 gb|ERN02340.1| hypothetical protein AMTR_s00096p00027330 [Ambore... 97 2e-23 >gb|PKI38653.1| hypothetical protein CRG98_040939 [Punica granatum] Length = 148 Score = 107 bits (266), Expect = 2e-26 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAIEC+MA Sbjct: 97 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIMA 147 >gb|POF04718.1| atp-citrate synthase alpha chain protein 3 [Quercus suber] Length = 225 Score = 105 bits (262), Expect = 7e-25 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVP+EVYGPEATMTGICKQAI+CVMA Sbjct: 173 HIYVRRGGPNYQTGLAKMRALGEELGVPIEVYGPEATMTGICKQAIDCVMA 223 >ref|XP_008360239.2| PREDICTED: ATP-citrate synthase alpha chain protein 3 [Malus domestica] Length = 149 Score = 102 bits (254), Expect = 2e-24 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVM 378 HI+VRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAIEC++ Sbjct: 97 HIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIV 146 >gb|OWM71041.1| hypothetical protein CDL15_Pgr011168 [Punica granatum] Length = 422 Score = 107 bits (266), Expect = 4e-24 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAIEC+MA Sbjct: 371 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIMA 421 >ref|XP_008351142.1| PREDICTED: ATP-citrate synthase alpha chain protein 2, partial [Malus domestica] Length = 255 Score = 103 bits (258), Expect = 5e-24 Identities = 47/50 (94%), Positives = 50/50 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVM 378 HI+VRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAIEC+M Sbjct: 203 HIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIM 252 >ref|XP_014626982.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Glycine max] gb|KRG96682.1| hypothetical protein GLYMA_19G226100 [Glycine max] Length = 209 Score = 102 bits (255), Expect = 5e-24 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVP++VYGPEATMTGICKQAI+C+M+ Sbjct: 157 HIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMS 207 >gb|KCW64419.1| hypothetical protein EUGRSUZ_G02039 [Eucalyptus grandis] Length = 422 Score = 105 bits (263), Expect = 1e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICK+AIEC+MA Sbjct: 370 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKEAIECIMA 420 >ref|XP_012088841.1| ATP-citrate synthase alpha chain protein 2 [Jatropha curcas] ref|XP_020540437.1| ATP-citrate synthase alpha chain protein 2 [Jatropha curcas] gb|KDP23347.1| hypothetical protein JCGZ_23180 [Jatropha curcas] Length = 423 Score = 105 bits (263), Expect = 1e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAI+C+M+ Sbjct: 371 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIDCIMS 421 >ref|XP_010066514.1| PREDICTED: ATP-citrate synthase alpha chain protein 3 [Eucalyptus grandis] gb|KCW64421.1| hypothetical protein EUGRSUZ_G02039 [Eucalyptus grandis] Length = 423 Score = 105 bits (263), Expect = 1e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICK+AIEC+MA Sbjct: 371 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKEAIECIMA 421 >emb|CDY31089.1| BnaA08g26390D [Brassica napus] Length = 206 Score = 101 bits (252), Expect = 1e-23 Identities = 45/50 (90%), Positives = 50/50 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVM 378 HIYVRRGGPNYQTGLA+MR+LGEELGVPLEVYGPEATMTGICK+AI+C+M Sbjct: 153 HIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIM 202 >gb|KJB45487.1| hypothetical protein B456_007G308700 [Gossypium raimondii] Length = 290 Score = 103 bits (257), Expect = 1e-23 Identities = 46/51 (90%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLA+MR+LGEELGVPLEVYGPEATMTGICKQAI+C+M+ Sbjct: 238 HIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKQAIDCIMS 288 >gb|AQK48282.1| ATP-citrate synthase alpha chain protein 3 [Zea mays] gb|AQK48283.1| ATP-citrate synthase alpha chain protein 3 [Zea mays] Length = 225 Score = 102 bits (253), Expect = 1e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQ+GLAKMR LG ELGVP+EVYGPEATMTGICKQAIEC+MA Sbjct: 173 HIYVRRGGPNYQSGLAKMRKLGAELGVPIEVYGPEATMTGICKQAIECIMA 223 >gb|KCW64420.1| hypothetical protein EUGRSUZ_G02039 [Eucalyptus grandis] Length = 452 Score = 105 bits (263), Expect = 2e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICK+AIEC+MA Sbjct: 400 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKEAIECIMA 450 >gb|PNT34284.1| hypothetical protein POPTR_005G004900v3 [Populus trichocarpa] Length = 363 Score = 104 bits (260), Expect = 2e-23 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAI+C+M+ Sbjct: 311 HIYVRRGGPNYQTGLAKMRTLGEELGVPLEVYGPEATMTGICKQAIDCIMS 361 >ref|XP_023917167.1| ATP-citrate synthase alpha chain protein 2 [Quercus suber] Length = 423 Score = 105 bits (262), Expect = 2e-23 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVP+EVYGPEATMTGICKQAI+CVMA Sbjct: 371 HIYVRRGGPNYQTGLAKMRALGEELGVPIEVYGPEATMTGICKQAIDCVMA 421 >gb|KHN43368.1| ATP-citrate synthase alpha chain protein 3 [Glycine soja] Length = 265 Score = 102 bits (255), Expect = 2e-23 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HIYVRRGGPNYQTGLAKMR+LGEELGVP++VYGPEATMTGICKQAI+C+M+ Sbjct: 213 HIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMS 263 >dbj|GAY58825.1| hypothetical protein CUMW_189770 [Citrus unshiu] Length = 266 Score = 102 bits (255), Expect = 2e-23 Identities = 45/51 (88%), Positives = 51/51 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 HI+VRRGGPNYQTGLAKMR+LGEELG+PLEVYGPEATMTGICKQAI+C+M+ Sbjct: 214 HIFVRRGGPNYQTGLAKMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 264 >gb|PNX65914.1| ATP-citrate synthase alpha chain protein 1-like, partial [Trifolium pratense] gb|PNX65939.1| ATP-citrate synthase alpha chain protein 1-like, partial [Trifolium pratense] Length = 62 Score = 97.1 bits (240), Expect = 2e-23 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 +IYVRRGGPNYQ GLAKMR+LGEE+G+P+EVYGPEATMTGICKQAI+C+ A Sbjct: 10 YIYVRRGGPNYQRGLAKMRALGEEIGIPIEVYGPEATMTGICKQAIQCITA 60 >ref|XP_017186531.1| PREDICTED: ATP-citrate synthase alpha chain protein 3, partial [Malus domestica] Length = 255 Score = 102 bits (254), Expect = 2e-23 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVM 378 HI+VRRGGPNYQTGLAKMR+LGEELGVPLEVYGPEATMTGICKQAIEC++ Sbjct: 203 HIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIV 252 >gb|ERN02340.1| hypothetical protein AMTR_s00096p00027330 [Amborella trichopoda] Length = 68 Score = 97.1 bits (240), Expect = 2e-23 Identities = 41/51 (80%), Positives = 49/51 (96%) Frame = -3 Query: 527 HIYVRRGGPNYQTGLAKMRSLGEELGVPLEVYGPEATMTGICKQAIECVMA 375 H+YVRRGGPNY+TGLAKMR+L EE+G+PLEVYGPEATMTGICK+AI+C+ A Sbjct: 16 HVYVRRGGPNYKTGLAKMRALAEEIGIPLEVYGPEATMTGICKEAIDCITA 66