BLASTX nr result
ID: Acanthopanax24_contig00006772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00006772 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN07962.1| hypothetical protein DCAR_000631 [Daucus carota s... 69 2e-10 gb|KZV17691.1| GPI transamidase component PIG-S-like [Dorcoceras... 69 2e-10 gb|PKI64816.1| hypothetical protein CRG98_014812 [Punica granatum] 64 2e-09 gb|KHN10979.1| GPI transamidase component PIG-S [Glycine soja] 64 2e-09 ref|XP_020976849.1| GPI transamidase component PIG-S isoform X2 ... 66 3e-09 gb|PIN08220.1| GPI transamidase complex, GPI17/PIG-S component [... 65 4e-09 ref|XP_011098455.1| GPI transamidase component PIG-S [Sesamum in... 65 4e-09 gb|AAX09335.1| putative phosphatidylinositol glycan class S, par... 61 6e-09 gb|PIA39290.1| hypothetical protein AQUCO_02600028v1 [Aquilegia ... 64 1e-08 ref|XP_012833539.1| PREDICTED: GPI transamidase component PIG-S ... 64 2e-08 emb|CDP03894.1| unnamed protein product [Coffea canephora] 63 2e-08 ref|XP_022727534.1| GPI transamidase component PIG-S-like isofor... 63 2e-08 ref|XP_019162096.1| PREDICTED: GPI transamidase component PIG-S-... 63 2e-08 ref|XP_019188468.1| PREDICTED: GPI transamidase component PIG-S-... 63 2e-08 emb|CAN78378.1| hypothetical protein VITISV_011026 [Vitis vinifera] 63 3e-08 emb|CBI18338.3| unnamed protein product, partial [Vitis vinifera] 63 3e-08 gb|ONH92854.1| hypothetical protein PRUPE_8G200200 [Prunus persica] 63 3e-08 ref|XP_017983821.1| PREDICTED: GPI transamidase component PIG-S ... 63 3e-08 gb|PNT51481.1| hypothetical protein POPTR_002G244800v3 [Populus ... 63 3e-08 ref|XP_002303053.2| GPI transamidase component PIG-S-related fam... 63 3e-08 >gb|KZN07962.1| hypothetical protein DCAR_000631 [Daucus carota subsp. sativus] Length = 519 Score = 68.9 bits (167), Expect = 2e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTVRPTIP 364 R+AR AEDAFFH SMMSVSYYSFEHCFAVY+VRP+ P Sbjct: 475 REARILAEDAFFHPSMMSVSYYSFEHCFAVYSVRPSRP 512 >gb|KZV17691.1| GPI transamidase component PIG-S-like [Dorcoceras hygrometricum] Length = 564 Score = 68.9 bits (167), Expect = 2e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTVR 352 RQARSFAEDAF+H SMMSVSYYSFEHCFAVY+VR Sbjct: 526 RQARSFAEDAFYHPSMMSVSYYSFEHCFAVYSVR 559 >gb|PKI64816.1| hypothetical protein CRG98_014812 [Punica granatum] Length = 182 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTV 349 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+V Sbjct: 145 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSV 177 >gb|KHN10979.1| GPI transamidase component PIG-S [Glycine soja] Length = 182 Score = 63.9 bits (154), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTVRP 355 RQ+RS AEDAFFH S+MS+SYYSFEHCFA+Y+V P Sbjct: 148 RQSRSLAEDAFFHPSIMSISYYSFEHCFAIYSVCP 182 >ref|XP_020976849.1| GPI transamidase component PIG-S isoform X2 [Arachis ipaensis] Length = 585 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTVRPTIPKED 373 RQARS EDAFFH S+MS+SYYSFEHCFA+Y+V P P ++ Sbjct: 542 RQARSLVEDAFFHPSIMSISYYSFEHCFAIYSVPPPPPHKE 582 >gb|PIN08220.1| GPI transamidase complex, GPI17/PIG-S component [Handroanthus impetiginosus] Length = 611 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARSFAEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 544 RQARSFAEDAFYHPSMMSVSYYSFEHCFAVYS 575 >ref|XP_011098455.1| GPI transamidase component PIG-S [Sesamum indicum] Length = 616 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARSFAEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 549 RQARSFAEDAFYHPSMMSVSYYSFEHCFAVYS 580 >gb|AAX09335.1| putative phosphatidylinositol glycan class S, partial [Fragaria x ananassa] Length = 118 Score = 61.2 bits (147), Expect = 6e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSV YYSFEHCFAVY+ Sbjct: 48 RQARSLAEDAFFHPSIMSVGYYSFEHCFAVYS 79 >gb|PIA39290.1| hypothetical protein AQUCO_02600028v1 [Aquilegia coerulea] Length = 587 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTV 349 RQAR+ AEDAFFH S+MS+SYYSFEHCFA+YTV Sbjct: 552 RQARALAEDAFFHPSIMSISYYSFEHCFAIYTV 584 >ref|XP_012833539.1| PREDICTED: GPI transamidase component PIG-S [Erythranthe guttata] gb|EYU40618.1| hypothetical protein MIMGU_mgv1a003001mg [Erythranthe guttata] Length = 617 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 R ARSFAEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 550 RHARSFAEDAFYHPSMMSVSYYSFEHCFAVYS 581 >emb|CDP03894.1| unnamed protein product [Coffea canephora] Length = 558 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 491 RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS 522 >ref|XP_022727534.1| GPI transamidase component PIG-S-like isoform X4 [Durio zibethinus] Length = 565 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYTV 349 RQARS AEDAFFH S+MSVSYYSFEHCFAVY++ Sbjct: 533 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSL 565 >ref|XP_019162096.1| PREDICTED: GPI transamidase component PIG-S-like [Ipomoea nil] Length = 598 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 531 RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS 562 >ref|XP_019188468.1| PREDICTED: GPI transamidase component PIG-S-like [Ipomoea nil] ref|XP_019188470.1| PREDICTED: GPI transamidase component PIG-S-like [Ipomoea nil] Length = 598 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAF+H SMMSVSYYSFEHCFAVY+ Sbjct: 531 RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS 562 >emb|CAN78378.1| hypothetical protein VITISV_011026 [Vitis vinifera] Length = 433 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 362 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 393 >emb|CBI18338.3| unnamed protein product, partial [Vitis vinifera] Length = 520 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 449 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 480 >gb|ONH92854.1| hypothetical protein PRUPE_8G200200 [Prunus persica] Length = 576 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 507 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 538 >ref|XP_017983821.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Theobroma cacao] gb|EOX93886.1| GPI transamidase component PIG-S-related [Theobroma cacao] Length = 582 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 512 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 543 >gb|PNT51481.1| hypothetical protein POPTR_002G244800v3 [Populus trichocarpa] Length = 584 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 514 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 545 >ref|XP_002303053.2| GPI transamidase component PIG-S-related family protein [Populus trichocarpa] Length = 584 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 251 RQARSFAEDAFFHSSMMSVSYYSFEHCFAVYT 346 RQARS AEDAFFH S+MSVSYYSFEHCFAVY+ Sbjct: 514 RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYS 545