BLASTX nr result
ID: Acanthopanax24_contig00006510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00006510 (993 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimoc... 110 6e-27 gb|KZN11977.1| hypothetical protein DCAR_004633 [Daucus carota s... 116 2e-25 ref|XP_017229228.1| PREDICTED: glutamate--cysteine ligase, chlor... 116 3e-25 gb|ABK23872.1| unknown [Picea sitchensis] 110 4e-25 ref|XP_021971117.1| glutamate--cysteine ligase, chloroplastic [H... 113 5e-25 emb|CDP09740.1| unnamed protein product [Coffea canephora] 115 6e-25 gb|OTG21898.1| putative glutamate--cysteine ligase, GCS2 [Helian... 113 7e-25 emb|CAC27145.1| glutamate-cysteine ligase, partial [Picea abies] 110 7e-25 gb|OMO79518.1| Glutamate--cysteine ligase, GCS2 [Corchorus capsu... 114 1e-24 gb|OMO58643.1| Glutamate--cysteine ligase, GCS2 [Corchorus olito... 114 1e-24 ref|XP_019264662.1| PREDICTED: glutamate--cysteine ligase, chlor... 114 1e-24 ref|NP_001312610.1| glutamate--cysteine ligase, chloroplastic [N... 114 1e-24 gb|OTF84860.1| putative glutamate--cysteine ligase protein [Heli... 114 1e-24 ref|XP_022025676.1| glutamate--cysteine ligase, chloroplastic [H... 114 1e-24 sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase,... 114 2e-24 ref|NP_001234010.2| glutamate--cysteine ligase, chloroplastic [S... 114 2e-24 ref|XP_016460741.1| PREDICTED: glutamate--cysteine ligase, chlor... 113 3e-24 ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chlor... 113 3e-24 ref|XP_022845500.1| glutamate--cysteine ligase, chloroplastic-li... 113 3e-24 gb|AFP93564.1| GCS [Cestrum nocturnum] 113 4e-24 >gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimocarpus longan] Length = 78 Score = 110 bits (276), Expect = 6e-27 Identities = 50/60 (83%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QD+++LAKDGLERRG+KE+GFLN VAEVVRTGVTPAEKLLE+YHGKWG+ VDPVF+ELLY Sbjct: 19 QDILKLAKDGLERRGFKESGFLNAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVFEELLY 78 >gb|KZN11977.1| hypothetical protein DCAR_004633 [Daucus carota subsp. sativus] Length = 443 Score = 116 bits (290), Expect = 2e-25 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDV+QLAKDGLERRG+KETGFLNEVAEV RTGVTPAEKLLELYHG WGE VDPVFQELLY Sbjct: 384 QDVMQLAKDGLERRGFKETGFLNEVAEVARTGVTPAEKLLELYHGNWGESVDPVFQELLY 443 >ref|XP_017229228.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Daucus carota subsp. sativus] ref|XP_017229229.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Daucus carota subsp. sativus] Length = 524 Score = 116 bits (290), Expect = 3e-25 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDV+QLAKDGLERRG+KETGFLNEVAEV RTGVTPAEKLLELYHG WGE VDPVFQELLY Sbjct: 465 QDVMQLAKDGLERRGFKETGFLNEVAEVARTGVTPAEKLLELYHGNWGESVDPVFQELLY 524 >gb|ABK23872.1| unknown [Picea sitchensis] Length = 209 Score = 110 bits (274), Expect = 4e-25 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +D++QLAK+GL+RRG KE+GFLNEVAEVVRTG+TPAE+LL+LYHGKWG CVDPVF+ELLY Sbjct: 150 EDILQLAKEGLQRRGCKESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 209 >ref|XP_021971117.1| glutamate--cysteine ligase, chloroplastic [Helianthus annuus] Length = 345 Score = 113 bits (282), Expect = 5e-25 Identities = 51/60 (85%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +DV+Q AKDGLERRGYKETGFLNEVAEVVRTG+TPAEK+L+LYHGKWG+ VDPVF+ELLY Sbjct: 286 EDVLQFAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKILDLYHGKWGQTVDPVFEELLY 345 >emb|CDP09740.1| unnamed protein product [Coffea canephora] Length = 611 Score = 115 bits (289), Expect = 6e-25 Identities = 54/60 (90%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAKDGLERRG+KETGFLNEVAEVV+TGVTPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 552 QDVVKLAKDGLERRGFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPVFEELLY 611 >gb|OTG21898.1| putative glutamate--cysteine ligase, GCS2 [Helianthus annuus] Length = 360 Score = 113 bits (282), Expect = 7e-25 Identities = 51/60 (85%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +DV+Q AKDGLERRGYKETGFLNEVAEVVRTG+TPAEK+L+LYHGKWG+ VDPVF+ELLY Sbjct: 301 EDVLQFAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKILDLYHGKWGQTVDPVFEELLY 360 >emb|CAC27145.1| glutamate-cysteine ligase, partial [Picea abies] Length = 230 Score = 110 bits (274), Expect = 7e-25 Identities = 48/60 (80%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +D++QLAK+GL+RRG KE+GFLNEVAEVVRTG+TPAE+LL+LYHGKWG CVDPVF+ELLY Sbjct: 171 EDILQLAKEGLQRRGCKESGFLNEVAEVVRTGITPAERLLDLYHGKWGNCVDPVFEELLY 230 >gb|OMO79518.1| Glutamate--cysteine ligase, GCS2 [Corchorus capsularis] Length = 522 Score = 114 bits (286), Expect = 1e-24 Identities = 53/60 (88%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +DV++LAKDGLERRGYKE+GFLNEVAEVVRTGVTPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 463 EDVLKLAKDGLERRGYKESGFLNEVAEVVRTGVTPAEKLLELYHGKWGQSVDPVFEELLY 522 >gb|OMO58643.1| Glutamate--cysteine ligase, GCS2 [Corchorus olitorius] Length = 522 Score = 114 bits (286), Expect = 1e-24 Identities = 53/60 (88%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 +DV++LAKDGLERRGYKE+GFLNEVAEVVRTGVTPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 463 EDVLKLAKDGLERRGYKESGFLNEVAEVVRTGVTPAEKLLELYHGKWGQSVDPVFEELLY 522 >ref|XP_019264662.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana attenuata] gb|OIT36259.1| glutamate--cysteine ligase, chloroplastic [Nicotiana attenuata] Length = 522 Score = 114 bits (286), Expect = 1e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRGYKETGFLNEV EVVRTGVTPAEKLLELYHGKWG VDPVF+ELLY Sbjct: 463 QDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522 >ref|NP_001312610.1| glutamate--cysteine ligase, chloroplastic [Nicotiana tabacum] ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana sylvestris] ref|XP_016478566.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana tabacum] sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum] Length = 522 Score = 114 bits (286), Expect = 1e-24 Identities = 54/60 (90%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRGYKETGFLNEV EVVRTGVTPAEKLLELYHGKWG VDPVF+ELLY Sbjct: 463 QDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522 >gb|OTF84860.1| putative glutamate--cysteine ligase protein [Helianthus annuus] Length = 520 Score = 114 bits (285), Expect = 1e-24 Identities = 53/60 (88%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 ++V+QLAKDGLERRGYKETGFLNEVAEVVRTG+TPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 461 EEVLQLAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQNVDPVFEELLY 520 >ref|XP_022025676.1| glutamate--cysteine ligase, chloroplastic [Helianthus annuus] ref|XP_022025677.1| glutamate--cysteine ligase, chloroplastic [Helianthus annuus] ref|XP_022025678.1| glutamate--cysteine ligase, chloroplastic [Helianthus annuus] Length = 523 Score = 114 bits (285), Expect = 1e-24 Identities = 53/60 (88%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 ++V+QLAKDGLERRGYKETGFLNEVAEVVRTG+TPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 464 EEVLQLAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQNVDPVFEELLY 523 >sp|O22493.1|GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gb|AAB71230.1| gamma-glutamylcysteine synthetase [Solanum lycopersicum] Length = 523 Score = 114 bits (284), Expect = 2e-24 Identities = 52/60 (86%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRG+KETGFLNEVAEVV+TGVTPAEKLLELYHGKWG+ VDP+F+ELLY Sbjct: 464 QDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY 523 >ref|NP_001234010.2| glutamate--cysteine ligase, chloroplastic [Solanum lycopersicum] ref|XP_010325297.1| PREDICTED: glutamate--cysteine ligase, chloroplastic isoform X1 [Solanum lycopersicum] gb|ACQ91100.1| GSH1 [Solanum lycopersicum] Length = 523 Score = 114 bits (284), Expect = 2e-24 Identities = 52/60 (86%), Positives = 59/60 (98%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRG+KETGFLNEVAEVV+TGVTPAEKLLELYHGKWG+ VDP+F+ELLY Sbjct: 464 QDVVKLAKEGLERRGFKETGFLNEVAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY 523 >ref|XP_016460741.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Nicotiana tabacum] Length = 522 Score = 113 bits (283), Expect = 3e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRGYKETGFLNEV EVV+TGVTPAEKLLELYHGKWG VDPVF+ELLY Sbjct: 463 QDVVKLAKEGLERRGYKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522 >ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana tomentosiformis] Length = 522 Score = 113 bits (283), Expect = 3e-24 Identities = 53/60 (88%), Positives = 57/60 (95%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDVV+LAK+GLERRGYKETGFLNEV EVV+TGVTPAEKLLELYHGKWG VDPVF+ELLY Sbjct: 463 QDVVKLAKEGLERRGYKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGRSVDPVFEELLY 522 >ref|XP_022845500.1| glutamate--cysteine ligase, chloroplastic-like [Olea europaea var. sylvestris] Length = 526 Score = 113 bits (283), Expect = 3e-24 Identities = 53/60 (88%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 Q+VV+LAKDGLERRGYKETGFLNE+ EVVRTGVTPAEKLLELYHGKWG+ VDPVF+ELLY Sbjct: 467 QEVVKLAKDGLERRGYKETGFLNEMNEVVRTGVTPAEKLLELYHGKWGQSVDPVFEELLY 526 >gb|AFP93564.1| GCS [Cestrum nocturnum] Length = 518 Score = 113 bits (282), Expect = 4e-24 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 993 QDVVQLAKDGLERRGYKETGFLNEVAEVVRTGVTPAEKLLELYHGKWGECVDPVFQELLY 814 QDV++LAK+GLERRGYKETGFLNEV EVVRTGVTPAEKLL+LYHGKWG+ VDPVF+ELLY Sbjct: 459 QDVMKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLDLYHGKWGQSVDPVFEELLY 518