BLASTX nr result
ID: Acanthopanax24_contig00004984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00004984 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009241115.1| Ycf2 (chloroplast) [Schefflera heptaphylla] ... 102 6e-22 ref|YP_009338467.1| hypothetical protein RF2 (chloroplast) [Pter... 102 6e-22 ref|YP_004733887.1| hypothetical chloroplast RF21 (chloroplast) ... 102 6e-22 gb|APB96451.1| hypothetical protein RF2 (plastid) [Daucus involu... 102 6e-22 gb|APB96027.1| hypothetical protein RF2 (plastid) [Daucus pusill... 102 6e-22 gb|APB96536.1| hypothetical protein RF2 (plastid) [Daucus involu... 102 6e-22 gb|APB96281.1| hypothetical protein RF2 (plastid) [Daucus conchi... 102 6e-22 gb|APB95857.1| hypothetical protein RF2 (plastid) [Daucus setulo... 102 6e-22 gb|APB95772.1| hypothetical protein RF2 (plastid) [Daucus guttat... 102 6e-22 gb|APB95687.1| hypothetical protein RF2 (plastid) [Daucus guttat... 102 6e-22 gb|APB95517.1| hypothetical protein RF2 (plastid) [Daucus littor... 102 6e-22 gb|APB95347.1| hypothetical protein RF2 (plastid) [Daucus guttat... 102 6e-22 gb|APB94667.1| hypothetical protein RF2 (plastid) [Daucus rouyi]... 102 6e-22 ref|YP_004733371.1| hypothetical chloroplast RF21 (chloroplast) ... 102 6e-22 ref|YP_009236008.1| hypothetical chloroplast RF2 (chloroplast) [... 102 6e-22 gb|APB95602.1| hypothetical protein RF2 (plastid) [Daucus glochi... 102 6e-22 gb|APB96366.1| hypothetical protein RF2 (plastid) [Daucus conchi... 102 6e-22 gb|APB96197.1| hypothetical protein RF2 (plastid) [Daucus conchi... 102 6e-22 gb|APB94837.1| hypothetical protein RF2 (plastid) [Daucus aureus... 102 6e-22 gb|ATI20906.1| Ycf2 (chloroplast) [Panax stipuleanatus] >gi|1252... 102 6e-22 >ref|YP_009241115.1| Ycf2 (chloroplast) [Schefflera heptaphylla] ref|YP_009241095.1| Ycf2 (chloroplast) [Schefflera heptaphylla] gb|AMK46217.1| Ycf2 (chloroplast) [Schefflera heptaphylla] gb|AMK46224.1| Ycf2 (chloroplast) [Schefflera heptaphylla] Length = 1467 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231 >ref|YP_009338467.1| hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] ref|YP_009338484.1| hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36562.1| hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] gb|ANK36579.1| hypothetical protein RF2 (chloroplast) [Pterygopleurum neurophyllum] Length = 2077 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231 >ref|YP_004733887.1| hypothetical chloroplast RF21 (chloroplast) [Petroselinum crispum] ref|YP_004733904.1| hypothetical chloroplast RF21 (chloroplast) [Petroselinum crispum] gb|ADK89995.1| hypothetical chloroplast RF21 (chloroplast) [Petroselinum crispum] gb|ADK90013.1| hypothetical chloroplast RF21 (chloroplast) [Petroselinum crispum] Length = 2081 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231 >gb|APB96451.1| hypothetical protein RF2 (plastid) [Daucus involucratus] gb|APB96468.1| hypothetical protein RF2 (plastid) [Daucus involucratus] Length = 2084 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB96027.1| hypothetical protein RF2 (plastid) [Daucus pusillus] gb|APB96044.1| hypothetical protein RF2 (plastid) [Daucus pusillus] gb|APB96112.1| hypothetical protein RF2 (plastid) [Daucus pusillus] gb|APB96129.1| hypothetical protein RF2 (plastid) [Daucus pusillus] Length = 2090 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB96536.1| hypothetical protein RF2 (plastid) [Daucus involucratus] gb|APB96553.1| hypothetical protein RF2 (plastid) [Daucus involucratus] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB96281.1| hypothetical protein RF2 (plastid) [Daucus conchitae] gb|APB96298.1| hypothetical protein RF2 (plastid) [Daucus conchitae] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB95857.1| hypothetical protein RF2 (plastid) [Daucus setulosus] gb|APB95874.1| hypothetical protein RF2 (plastid) [Daucus setulosus] gb|APB95942.1| hypothetical protein RF2 (plastid) [Daucus setulosus] gb|APB95959.1| hypothetical protein RF2 (plastid) [Daucus setulosus] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB95772.1| hypothetical protein RF2 (plastid) [Daucus guttatus] gb|APB95789.1| hypothetical protein RF2 (plastid) [Daucus guttatus] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB95687.1| hypothetical protein RF2 (plastid) [Daucus guttatus] gb|APB95704.1| hypothetical protein RF2 (plastid) [Daucus guttatus] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB95517.1| hypothetical protein RF2 (plastid) [Daucus littoralis] gb|APB95534.1| hypothetical protein RF2 (plastid) [Daucus littoralis] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB95347.1| hypothetical protein RF2 (plastid) [Daucus guttatus] gb|APB95364.1| hypothetical protein RF2 (plastid) [Daucus guttatus] gb|APB95432.1| hypothetical protein RF2 (plastid) [Daucus guttatus] gb|APB95449.1| hypothetical protein RF2 (plastid) [Daucus guttatus] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB94667.1| hypothetical protein RF2 (plastid) [Daucus rouyi] gb|APB94684.1| hypothetical protein RF2 (plastid) [Daucus rouyi] Length = 2091 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >ref|YP_004733371.1| hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] ref|YP_004733388.1| hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] gb|ADK89907.1| hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] gb|ADK89925.1| hypothetical chloroplast RF21 (chloroplast) [Crithmum maritimum] Length = 2092 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231 >ref|YP_009236008.1| hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] ref|YP_009236025.1| hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] gb|ABU85175.1| hypothetical protein RF2, partial (chloroplast) [Anethum graveolens] gb|AMD84044.1| hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] gb|AMD84062.1| hypothetical chloroplast RF2 (chloroplast) [Anethum graveolens] Length = 2092 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231 >gb|APB95602.1| hypothetical protein RF2 (plastid) [Daucus glochidiatus] gb|APB95619.1| hypothetical protein RF2 (plastid) [Daucus glochidiatus] Length = 2096 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB96366.1| hypothetical protein RF2 (plastid) [Daucus conchitae] gb|APB96383.1| hypothetical protein RF2 (plastid) [Daucus conchitae] Length = 2097 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB96197.1| hypothetical protein RF2 (plastid) [Daucus conchitae] gb|APB96214.1| hypothetical protein RF2 (plastid) [Daucus conchitae] Length = 2097 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|APB94837.1| hypothetical protein RF2 (plastid) [Daucus aureus] gb|APB94854.1| hypothetical protein RF2 (plastid) [Daucus aureus] Length = 2102 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 177 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 232 >gb|ATI20906.1| Ycf2 (chloroplast) [Panax stipuleanatus] gb|ATI20926.1| Ycf2 (chloroplast) [Panax stipuleanatus] Length = 2103 Score = 102 bits (255), Expect = 6e-22 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 WGSR*WRN*IQKKRDSSQLKGSSDQSRNPLDSISNEDSEYHTLINQREIQQLKEKT 169 WGSR WRN I KKRDSSQLKGSSDQSR+PLDSISNEDSEYHTLINQREIQQLKE++ Sbjct: 176 WGSRWWRNWIGKKRDSSQLKGSSDQSRDPLDSISNEDSEYHTLINQREIQQLKERS 231