BLASTX nr result
ID: Acanthopanax24_contig00003688
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00003688 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00520.1| unnamed protein product [Coffea canephora] 131 5e-32 gb|KZV18629.1| protein NSP-INTERACTING KINASE 1 [Dorcoceras hygr... 130 1e-31 ref|XP_022888302.1| protein NSP-INTERACTING KINASE 2-like [Olea ... 129 2e-31 emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] 129 3e-31 ref|XP_015894250.1| PREDICTED: protein NSP-INTERACTING KINASE 2 ... 129 3e-31 ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 129 3e-31 ref|XP_015075652.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 128 4e-31 dbj|GAV66917.1| LRRNT_2 domain-containing protein, partial [Ceph... 120 4e-31 ref|XP_015075651.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 128 4e-31 ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 ... 128 4e-31 ref|XP_011070875.1| protein NSP-INTERACTING KINASE 2-like [Sesam... 128 4e-31 gb|PHT33508.1| Protein NSP-INTERACTING KINASE 3 [Capsicum baccatum] 128 4e-31 gb|PHU02171.1| Protein NSP-INTERACTING KINASE 1 [Capsicum chinense] 128 4e-31 ref|XP_016548068.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 128 4e-31 gb|OMO72270.1| hypothetical protein COLO4_27736 [Corchorus olito... 127 5e-31 gb|PIN25917.1| Serine/threonine protein kinase [Handroanthus imp... 127 9e-31 ref|XP_017226559.1| PREDICTED: protein NSP-INTERACTING KINASE 1-... 127 1e-30 ref|XP_022733008.1| protein NSP-INTERACTING KINASE 2-like [Durio... 127 1e-30 gb|OMO93693.1| hypothetical protein CCACVL1_06385 [Corchorus cap... 127 1e-30 ref|XP_017971040.1| PREDICTED: protein NSP-INTERACTING KINASE 2 ... 127 1e-30 >emb|CDP00520.1| unnamed protein product [Coffea canephora] Length = 623 Score = 131 bits (329), Expect = 5e-32 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLT+DSSLLVQAM Sbjct: 558 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTDDSSLLVQAM 617 Query: 181 ELSGPR 198 ELSGPR Sbjct: 618 ELSGPR 623 >gb|KZV18629.1| protein NSP-INTERACTING KINASE 1 [Dorcoceras hygrometricum] Length = 585 Score = 130 bits (326), Expect = 1e-31 Identities = 64/66 (96%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQ+AEATRCRANEFSSSERYSDLT+DSSLLVQAM Sbjct: 520 LPSHRPKMSEVVRMLEGDGLAEKWEASQKAEATRCRANEFSSSERYSDLTDDSSLLVQAM 579 Query: 181 ELSGPR 198 ELSGPR Sbjct: 580 ELSGPR 585 >ref|XP_022888302.1| protein NSP-INTERACTING KINASE 2-like [Olea europaea var. sylvestris] Length = 621 Score = 129 bits (324), Expect = 2e-31 Identities = 63/66 (95%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 +PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAM Sbjct: 556 IPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAM 615 Query: 181 ELSGPR 198 ELSGPR Sbjct: 616 ELSGPR 621 >emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera] Length = 609 Score = 129 bits (323), Expect = 3e-31 Identities = 63/66 (95%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEA+QRAEATRC+ANEFSSSERYSDLT+DSSLLVQAM Sbjct: 544 LPSHRPKMSEVVRMLEGDGLAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAM 603 Query: 181 ELSGPR 198 ELSGPR Sbjct: 604 ELSGPR 609 >ref|XP_015894250.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Ziziphus jujuba] Length = 623 Score = 129 bits (323), Expect = 3e-31 Identities = 63/66 (95%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRAN+FSSSERYSDLT+DSSLLVQAM Sbjct: 558 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANDFSSSERYSDLTDDSSLLVQAM 617 Query: 181 ELSGPR 198 ELSGPR Sbjct: 618 ELSGPR 623 >ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera] emb|CBI27432.3| unnamed protein product, partial [Vitis vinifera] Length = 625 Score = 129 bits (323), Expect = 3e-31 Identities = 63/66 (95%), Positives = 66/66 (100%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEA+QRAEATRC+ANEFSSSERYSDLT+DSSLLVQAM Sbjct: 560 LPSHRPKMSEVVRMLEGDGLAEKWEATQRAEATRCKANEFSSSERYSDLTDDSSLLVQAM 619 Query: 181 ELSGPR 198 ELSGPR Sbjct: 620 ELSGPR 625 >ref|XP_015075652.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Solanum pennellii] ref|XP_015075653.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Solanum pennellii] Length = 586 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 522 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 581 Query: 184 LSGPR 198 LSGPR Sbjct: 582 LSGPR 586 >dbj|GAV66917.1| LRRNT_2 domain-containing protein, partial [Cephalotus follicularis] Length = 168 Score = 120 bits (301), Expect = 4e-31 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVV MLEGDGLAEKWEA+QRAEA R RANEFSSSERYSDLT+DSSLLVQAM Sbjct: 103 LPSHRPKMSEVVWMLEGDGLAEKWEATQRAEAIRYRANEFSSSERYSDLTDDSSLLVQAM 162 Query: 181 ELSGPR 198 ELSGPR Sbjct: 163 ELSGPR 168 >ref|XP_015075651.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Solanum pennellii] Length = 621 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 557 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 616 Query: 184 LSGPR 198 LSGPR Sbjct: 617 LSGPR 621 >ref|XP_004238998.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum] Length = 621 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 557 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 616 Query: 184 LSGPR 198 LSGPR Sbjct: 617 LSGPR 621 >ref|XP_011070875.1| protein NSP-INTERACTING KINASE 2-like [Sesamum indicum] Length = 623 Score = 128 bits (322), Expect = 4e-31 Identities = 63/66 (95%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LP+HRPKMSEVVRMLEGDGLAEKWEASQRAE TRCRANEFSSSERYSDLT+DSSLLVQAM Sbjct: 558 LPNHRPKMSEVVRMLEGDGLAEKWEASQRAEVTRCRANEFSSSERYSDLTDDSSLLVQAM 617 Query: 181 ELSGPR 198 ELSGPR Sbjct: 618 ELSGPR 623 >gb|PHT33508.1| Protein NSP-INTERACTING KINASE 3 [Capsicum baccatum] Length = 626 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 562 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 621 Query: 184 LSGPR 198 LSGPR Sbjct: 622 LSGPR 626 >gb|PHU02171.1| Protein NSP-INTERACTING KINASE 1 [Capsicum chinense] Length = 627 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 563 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 622 Query: 184 LSGPR 198 LSGPR Sbjct: 623 LSGPR 627 >ref|XP_016548068.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Capsicum annuum] gb|PHT67447.1| Protein NSP-INTERACTING KINASE 1 [Capsicum annuum] Length = 627 Score = 128 bits (322), Expect = 4e-31 Identities = 63/65 (96%), Positives = 65/65 (100%) Frame = +1 Query: 4 PSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAME 183 PSHRPKMSEVVRMLEGDGLAEKWEASQRAE+TRCRANEFSSSERYSDLT+DSSLLVQAME Sbjct: 563 PSHRPKMSEVVRMLEGDGLAEKWEASQRAESTRCRANEFSSSERYSDLTDDSSLLVQAME 622 Query: 184 LSGPR 198 LSGPR Sbjct: 623 LSGPR 627 >gb|OMO72270.1| hypothetical protein COLO4_27736 [Corchorus olitorius] Length = 511 Score = 127 bits (319), Expect = 5e-31 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATR RANEFSSSERYSDLT+DSSLLVQAM Sbjct: 446 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAM 505 Query: 181 ELSGPR 198 ELSGPR Sbjct: 506 ELSGPR 511 >gb|PIN25917.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 588 Score = 127 bits (319), Expect = 9e-31 Identities = 63/66 (95%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRAN+FSSS RYSDLT+DSSLLVQAM Sbjct: 523 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANDFSSSGRYSDLTDDSSLLVQAM 582 Query: 181 ELSGPR 198 ELSGPR Sbjct: 583 ELSGPR 588 >ref|XP_017226559.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Daucus carota subsp. sativus] gb|KZM82568.1| hypothetical protein DCAR_030137 [Daucus carota subsp. sativus] Length = 623 Score = 127 bits (319), Expect = 1e-30 Identities = 62/66 (93%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LP HRPKMSEVVRMLEGDGLAEKWEA+QRAEATRCRANEFSSSERYSDLT+DSS+LVQAM Sbjct: 558 LPGHRPKMSEVVRMLEGDGLAEKWEATQRAEATRCRANEFSSSERYSDLTDDSSVLVQAM 617 Query: 181 ELSGPR 198 ELSGPR Sbjct: 618 ELSGPR 623 >ref|XP_022733008.1| protein NSP-INTERACTING KINASE 2-like [Durio zibethinus] Length = 624 Score = 127 bits (319), Expect = 1e-30 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATR RANEFSSSERYSDLT+DSSLLVQAM Sbjct: 559 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAM 618 Query: 181 ELSGPR 198 ELSGPR Sbjct: 619 ELSGPR 624 >gb|OMO93693.1| hypothetical protein CCACVL1_06385 [Corchorus capsularis] Length = 624 Score = 127 bits (319), Expect = 1e-30 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATR RANEFSSSERYSDLT+DSSLLVQAM Sbjct: 559 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAM 618 Query: 181 ELSGPR 198 ELSGPR Sbjct: 619 ELSGPR 624 >ref|XP_017971040.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Theobroma cacao] ref|XP_017971041.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Theobroma cacao] Length = 624 Score = 127 bits (319), Expect = 1e-30 Identities = 64/66 (96%), Positives = 65/66 (98%) Frame = +1 Query: 1 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRCRANEFSSSERYSDLTNDSSLLVQAM 180 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATR RANEFSSSERYSDLT+DSSLLVQAM Sbjct: 559 LPSHRPKMSEVVRMLEGDGLAEKWEASQRAEATRSRANEFSSSERYSDLTDDSSLLVQAM 618 Query: 181 ELSGPR 198 ELSGPR Sbjct: 619 ELSGPR 624