BLASTX nr result
ID: Acanthopanax24_contig00003673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00003673 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017229686.1| PREDICTED: probable serine/threonine-protein... 57 9e-06 >ref|XP_017229686.1| PREDICTED: probable serine/threonine-protein kinase mkcF isoform X1 [Daucus carota subsp. sativus] gb|KZN09857.1| hypothetical protein DCAR_002513 [Daucus carota subsp. sativus] Length = 761 Score = 56.6 bits (135), Expect = 9e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 627 NRPTFQELLEKLKDMQRQYAINSKQPAPMQDIPP 526 +RPTFQELLE+LKD+QRQYAI KQ MQDIPP Sbjct: 728 DRPTFQELLERLKDLQRQYAIQFKQNTSMQDIPP 761