BLASTX nr result
ID: Acanthopanax24_contig00003247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00003247 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017226503.1| PREDICTED: uncharacterized protein LOC108202... 60 1e-07 >ref|XP_017226503.1| PREDICTED: uncharacterized protein LOC108202557 [Daucus carota subsp. sativus] gb|KZM81854.1| hypothetical protein DCAR_029467 [Daucus carota subsp. sativus] Length = 918 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = +1 Query: 1 CSEWGDHYXXXXXXXXXXMAERESRSEVGTRSNFGSSVHSEAKA 132 CSEWGDHY +AERESRSE TRSNFGSSVHSEAK+ Sbjct: 382 CSEWGDHYSTTTSSSDDELAERESRSE-ATRSNFGSSVHSEAKS 424