BLASTX nr result
ID: Acanthopanax24_contig00003189
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00003189 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU15947.1| hypothetical protein BC332_17152 [Capsicum chinense] 55 8e-06 gb|PHT46765.1| hypothetical protein CQW23_15923 [Capsicum baccatum] 55 8e-06 >gb|PHU15947.1| hypothetical protein BC332_17152 [Capsicum chinense] Length = 491 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 502 NGNYDKVLRSAVVGILIFAVLIALIMGIYDPESRPVLSP 386 N N D+VLR AV+ IL+F VL+A I G+YDPESRP+L P Sbjct: 453 NYNCDQVLRKAVISILLFWVLVAFIAGVYDPESRPILPP 491 >gb|PHT46765.1| hypothetical protein CQW23_15923 [Capsicum baccatum] Length = 491 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 502 NGNYDKVLRSAVVGILIFAVLIALIMGIYDPESRPVLSP 386 N N D+VLR AV+ IL+F VL+A I G+YDPESRP L P Sbjct: 453 NSNCDQVLRKAVISILLFWVLVAFIAGVYDPESRPTLPP 491