BLASTX nr result
ID: Acanthopanax24_contig00002458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00002458 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017230244.1| PREDICTED: dormancy-associated protein homol... 55 1e-06 >ref|XP_017230244.1| PREDICTED: dormancy-associated protein homolog 3-like [Daucus carota subsp. sativus] Length = 126 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 473 GGSFRFRRRTASETYEKATGIGSWSPRPPYDL 378 GGSF+FRRR+ ETYEKA+GIG SPRPPYD+ Sbjct: 95 GGSFQFRRRSVLETYEKASGIGFKSPRPPYDI 126